PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002209P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 339aa    MW: 37715.4 Da    PI: 4.3862
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002209P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-19104157356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  MELO3C002209P1 104 KKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWK 157
                     56689************************************************9 PP

2HD-ZIP_I/II130.18.6e-42103193191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekkrrl+ +qv++LE+sFe+e+kLeperKv+la++Lglqprqva+WFqnrRAR+ktkqlEkdyeaL+++y +lk + e+L ke+++L++e+
  MELO3C002209P1 103 EKKRRLTVDQVRFLEKSFETENKLEPERKVQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYEALQSSYGSLKVDYENLLKEKDSLKAEI 193
                     69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1989161IPR009057Homeodomain-like
PROSITE profilePS5007117.26599159IPR001356Homeobox domain
SMARTSM003893.2E-19102163IPR001356Homeobox domain
PfamPF000461.5E-16104157IPR001356Homeobox domain
CDDcd000862.70E-18104160No hitNo description
Gene3DG3DSA:1.10.10.601.5E-19106166IPR009057Homeodomain-like
PRINTSPR000319.9E-6130139IPR000047Helix-turn-helix motif
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PRINTSPR000319.9E-6139155IPR000047Helix-turn-helix motif
PfamPF021832.8E-14159200IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAGRRVYGGD DGGSISGGSS NHSVLLQNCG GSFASEPLNA LFLSGSSSSS SPSLLDCSGV  60
GSRSMMSFED IRGGNGSNRS FFCPLDSEDN GDEDLDDYFH HPEKKRRLTV DQVRFLEKSF  120
ETENKLEPER KVQLAKDLGL QPRQVAIWFQ NRRARWKTKQ LEKDYEALQS SYGSLKVDYE  180
NLLKEKDSLK AEILLLTDKL LHKEKERGNS VLSEVDKFGE ELPHNLVADS NLEDEVSKSS  240
KLGCKQEDIS SVKSDLCDSD SPHYTDGVHS SLLEPGDSSY IFDPDQSDLS QDEEDNLGRN  300
LLPPYIFPKL EDVDYSDPPT SSCNFVFPIE DNALWSWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151159RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437622.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A1S3AU520.0A0A1S3AU52_CUCME; homeobox-leucine zipper protein HAT5-like isoform X1
STRINGXP_008437622.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-45homeobox 1