PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002153P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 355aa    MW: 40037.3 Da    PI: 9.1473
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002153P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.5e-31175228255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MELO3C002153P1 175 PRMRWTSSLHARFIRAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 228
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-28173229IPR009057Homeodomain-like
SuperFamilySSF466894.3E-15173229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23175228IPR006447Myb domain, plants
PfamPF002493.0E-7176227IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MLEKGTIVPD LSLQISPPKS NQSLSFDIWP QQMQVQQVDT ELSLSNNSTS AIDVSTDRFR  60
PIRGIPVYNN GLLSSSRYFN RNQQPTTSST SPPPCLSFRA FQQQQEAVGR YNGITMEGLR  120
NQEQNFNHQN QNHQFVFQNQ QSLHFGVSDF SSNYSNNRSR LLMPRIQSRR NARAPRMRWT  180
SSLHARFIRA VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK NTDKQTASSE  240
GSGEEDFLPA TPTPHHEANC LLNHRRNFTN NPSSLDHPLP HLNNGISTPS SINNHSNSSR  300
RAWEQGSPGN ANVFGSENQS EECYELGHPN SLMGLNLNLN SPSKEISMKH NWHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17176230357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-17176230458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467044.10.0PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLA0A1S3CSL40.0A0A1S3CSL4_CUCME; transcription repressor KAN1-like isoform X1
STRINGXP_008467044.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.19e-42G2-like family protein