PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002038P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 181aa    MW: 20501.4 Da    PI: 9.8235
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002038P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP85.61.2e-2648122379
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                     g+kdrhsk++T +g+RdRR+Rls+++a++++dLq++LG+ ++sk i+WL+     +i++l+ + +++  +   ++s 
  MELO3C002038P1  48 GGKDRHSKVCTIKGLRDRRIRLSIPTAIQLYDLQNKLGLSQPSKVIDWLIDVTRFEIDKLPPLHFPKDFDP--NASI 122
                     68*************************************************************55555322..1221 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.94849107IPR017887Transcription factor TCP subgroup
PfamPF036346.1E-2549129IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MISKLKEDGA HDEAKQMEGK RKKARTCSRQ GQFLRGNPRI FRVSPFFGGK DRHSKVCTIK  60
GLRDRRIRLS IPTAIQLYDL QNKLGLSQPS KVIDWLIDVT RFEIDKLPPL HFPKDFDPNA  120
SILHHSDIGG DAALMKAKNE ETDQTLLVQT NDINGDSSHF EPPSFPFPFM YQTNSSPFSF  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-1854108155Putative transcription factor PCF6
5zkt_B4e-1854108155Putative transcription factor PCF6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445912.11e-132PREDICTED: transcription factor TCP5
TrEMBLA0A1S3BEN21e-131A0A1S3BEN2_CUCME; transcription factor TCP5
STRINGXP_008445912.11e-131(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.15e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5