PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C000076P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 100aa    MW: 10950.4 Da    PI: 6.0626
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C000076P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26042.42e-1314061100
          DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     +vyeA+ar+rdPvyG+vg i++lqqq++ l+++la +++e
  MELO3C000076P1   1 MVYEANARVRDPVYGCVGAISSLQQQIDLLQTQLAIAQAE 40 
                     69*********************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.3E-11138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.636141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MVYEANARVR DPVYGCVGAI SSLQQQIDLL QTQLAIAQAE VVHMRMRHIP SSSYNPTMGH  60
SSETASPSSK MNIPVPNKSY FSMDMVDHDS MGETLWSSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6837061e-167LN683706.1 Cucumis melo genomic scaffold, unassembled_sequence31212.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467061.19e-70PREDICTED: LOB domain-containing protein 4-like, partial
SwissprotQ9SHE93e-24LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0A0KBA84e-66A0A0A0KBA8_CUCSA; Uncharacterized protein
STRINGSolyc11g045530.1.11e-37(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-16LOB domain-containing protein 4