PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla023408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 320aa    MW: 36095.7 Da    PI: 9.2766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla023408genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-53171451128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v+++  +++
  Cla023408  17 LPPGFRFHPTDEELVVHYLKKKATSLPLPV-AIIAEVDLYKYDPWELPAKASYGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVIASseGNR 115
                79****************************.88***************9888999*************************************99877888 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kk Lvfy g+ p+g kt+W+mheyrl
  Cla023408 116 KVGVKKALVFYGGKPPRGIKTNWIMHEYRL 145
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6413183IPR003441NAC domain
PROSITE profilePS5100561.63717183IPR003441NAC domain
PfamPF023656.4E-2818145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MENSKSAPET NSERPNLPPG FRFHPTDEEL VVHYLKKKAT SLPLPVAIIA EVDLYKYDPW  60
ELPAKASYGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVIAS SEGNRKVGVK  120
KALVFYGGKP PRGIKTNWIM HEYRLADNNL GSGNNNKPRG FNIGGKKNSL RLDDWVLCRI  180
YKKTNSNKPG MDHEREDCFD YMVGSIPSSI QVNGYSQPMT TSTTTMTTNF SMYSELPSLS  240
LPMKRLLQPP SWEEEEYRST DDRPLSKRVQ LINGGGSGDN SIAALLSQLP SLQQPTRQGC  300
IIGDEIFRPA FQLPETNWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-711618614171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2135570.0EF213557.1 Cucumis melo NAC transcription factor (JA) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147807.10.0PREDICTED: NAC domain-containing protein 18-like
SwissprotQ9LD441e-103NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0A0LGE30.0A0A0A0LGE3_CUCSA; Uncharacterized protein
STRINGXP_004147807.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2488033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-101NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]