PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla022679
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 188aa    MW: 21113 Da    PI: 7.6232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla022679genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260104.21.2e-3229125197
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                aCaaCk++rrkC++dC+lapyfpa++ ++f+nv+klFG+++vlk+l++l++++r +a++++++eA++ra+d   G++++i +lq+++  l+a+   +
  Cla022679  29 ACAACKFQRRKCSADCPLAPYFPAHRVQDFQNVRKLFGVKKVLKTLADLEPDNRFKAVECIIFEANCRASDLAGGCYKIICELQSEITLLEAQHRIV 125
                7***************************************************************************************999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.19528129IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-3229123IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MNISGDSSGT AAEEGGVKDN NNHPTTQAAC AACKFQRRKC SADCPLAPYF PAHRVQDFQN  60
VRKLFGVKKV LKTLADLEPD NRFKAVECII FEANCRASDL AGGCYKIICE LQSEITLLEA  120
QHRIVLRQLR YCRQTAAISQ SGATSSEFDF NWKPGLISED WIRKENCNLN DRLTMMENEV  180
SFFKALTH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011650178.15e-74PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A0A0LNK65e-74A0A0A0LNK6_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-28LOB domain-containing protein 22