PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla022514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 433aa    MW: 48566.5 Da    PI: 5.9555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla022514genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM286e-093716333128
        NAM  33 vikevdiykvePwdLp.k..kvkaeek..ewyfFskrdkkya...tgkrknra..............................tksgyWkatgkdkevls 94 
                 +++++ ++++P++Lp +        +  +++ F +  +k     tg                                    ++ g Wk +g   +++s
  Cla022514  37 NVHDINPFQCKPENLPgTsyV--FPVTiiHVFNFLSFLEKCGitrTGY----DdvhqvsrplevlwvehyevwyyvprngngdISFGPWKPKGGACKLYS 130
                466777777777777732221..2222123333333222222111222....122234445666666666666666666666677899************ PP

        NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 ++  +g ++t  +y+g+ap+ +kt Wvm+ y +
  Cla022514 131 -DSFSTGWRTTYEYYEGQAPHDRKTAWVMQKYWM 163
                .9999***************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100511.96340186IPR003441NAC domain
SuperFamilySSF1019413.53E-1395185IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MTPSPITSSA TLDLFSTHKE TFLALGRILN GGPFPENVHD INPFQCKPEN LPGTSYVFPV  60
TIIHVFNFLS FLEKCGITRT GYDDVHQVSR PLEVLWVEHY EVWYYVPRNG NGDISFGPWK  120
PKGGACKLYS DSFSTGWRTT YEYYEGQAPH DRKTAWVMQK YWMSQTDPCE NSKQKETSSL  180
CKVFLGDEQF QNHEKIVKII NSEPNNLNHQ LVVPDGSTSN NMANGSTSKS EMSEDDKMVE  240
LAVAGKPLVH YSEEIVAEMD DFFEGDYLEL LDLDIPTSPS SSSENSSCLT MSSDDDFDTM  300
DVLCDAERDI NQDRAQRDAA CIRSSAPSRL KKEVVHQGAS ESLVIIRRSH SPAKENLKTD  360
STVSGSGCRE PDLKLPSQSE EEGYRLKGVS SSHKKLVSNG QETAVDGGKK KKKKAVGSRM  420
KKIRKKYFCF IPF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409421KKKKKAVGSRMKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818232e-75LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132572e-75LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444686.10.0PREDICTED: NAC domain-containing protein 13-like
RefseqXP_016900048.10.0PREDICTED: NAC domain-containing protein 13-like
TrEMBLA0A1S3BBN60.0A0A1S3BBN6_CUCME; NAC domain-containing protein 13-like
STRINGXP_008444686.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.19e-09NAC domain containing protein 28