PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla021917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 336aa    MW: 38122.7 Da    PI: 6.8323
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla021917genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.39e-51361651128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                lppG+rFhPtdeel+ +yL+ kv + ++  + v i evd++++ePw+Lp+++k +e+ewyfFs r +ky+tg r+nrat +gyWkatgkd++++s+ +g 
  Cla021917  36 LPPGYRFHPTDEELIAFYLASKVFKPSNFHHGVnIVEVDLNRCEPWELPEEAKMGEREWYFFSLRVRKYPTGLRTNRATMAGYWKATGKDRQIHSScNGV 135
                79********************999885444666***************99999*****************************************98999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                + g+kktLvfykg ap+g+kt+Wvmheyrl
  Cla021917 136 KLGTKKTLVFYKGGAPRGVKTKWVMHEYRL 165
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.63E-6035188IPR003441NAC domain
PROSITE profilePS5100555.62436188IPR003441NAC domain
PfamPF023651.1E-2537165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MFGIEEVIGE LNREEEEEEE GDNGKEIIKN NKHRLLPPGY RFHPTDEELI AFYLASKVFK  60
PSNFHHGVNI VEVDLNRCEP WELPEEAKMG EREWYFFSLR VRKYPTGLRT NRATMAGYWK  120
ATGKDRQIHS SCNGVKLGTK KTLVFYKGGA PRGVKTKWVM HEYRLHSDLA SPNVCKQDEW  180
VLCRIIHKSG EKLKPRSLQE AIPSPISLPP LSLDTPQTIH RNNIRFQTAL HNNNNNNIHR  240
HENSLESFII NNPHFIFQSN LFPFGLNNHL DDTPPSIQAT DTNYHAHFNP SLLLEGSCDS  300
RQASSFGVDS GGTLVDVAAY GGGRGDQSDE NWSGGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-483619417171NO APICAL MERISTEM PROTEIN
1ut4_B7e-483619417171NO APICAL MERISTEM PROTEIN
1ut7_A7e-483619417171NO APICAL MERISTEM PROTEIN
1ut7_B7e-483619417171NO APICAL MERISTEM PROTEIN
3swm_A7e-483619420174NAC domain-containing protein 19
3swm_B7e-483619420174NAC domain-containing protein 19
3swm_C7e-483619420174NAC domain-containing protein 19
3swm_D7e-483619420174NAC domain-containing protein 19
3swp_A7e-483619420174NAC domain-containing protein 19
3swp_B7e-483619420174NAC domain-containing protein 19
3swp_C7e-483619420174NAC domain-containing protein 19
3swp_D7e-483619420174NAC domain-containing protein 19
4dul_A7e-483619417171NAC domain-containing protein 19
4dul_B7e-483619417171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818221e-122LN681822.1 Cucumis melo genomic scaffold, anchoredscaffold00096.
GenBankLN7132571e-122LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464816.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3 isoform X1
SwissprotQ9S8518e-77NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A1S3CMC20.0A0A1S3CMC2_CUCME; protein CUP-SHAPED COTYLEDON 3 isoform X1
STRINGXP_008464816.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2485033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-76NAC family protein
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]