PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla021212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB_related
Protein Properties Length: 314aa    MW: 34980.6 Da    PI: 9.9908
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla021212genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-135498147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
        Cla021212 54 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 98
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.21E-1748104IPR009057Homeodomain-like
PROSITE profilePS5129415.21149103IPR017930Myb domain
TIGRFAMsTIGR015571.9E-1852101IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.4E-652104IPR009057Homeodomain-like
SMARTSM007175.3E-1153101IPR001005SANT/Myb domain
PfamPF002492.5E-115498IPR001005SANT/Myb domain
CDDcd001671.82E-85699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSHFPGVDSV RPPIASLRTA APPTTSTSNS VTAFPVSDDA SKKIRKPYTI TKSRESWTEQ  60
EHDKFLEALQ LFDRDWKKIE AFVGSKTVIQ IRSHAQKYFL KIQKSGKSEH VPPPRPKKKA  120
SHPYPQKAPK NATTQSPGMY QHLSSPFKPS YIYIPDSTAG FGLPSPNATF TSWSCSPVPT  180
IDVSQVPKGG PTLAHSSSSE STPRSWKLGE ISDQGDQGMR NRVMPDFAQV YSFIGSVFDP  240
TVSGHLQRLR KMDPINLETA LLLMQNLAIN LISPEFEDHR RLISSYDEDM QKAKSGNLFN  300
NLYNVRSDNT ILSA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818487e-75LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132607e-75LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437998.10.0PREDICTED: protein REVEILLE 6 isoform X2
RefseqXP_008437999.10.0PREDICTED: protein REVEILLE 6 isoform X2
SwissprotQ8H0W31e-105RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A1S3AVA90.0A0A1S3AVA9_CUCME; protein REVEILLE 6 isoform X2
STRINGXP_008437994.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-108MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]