PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla021063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 460aa    MW: 52592.7 Da    PI: 5.1513
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla021063genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.87.1e-39131352128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                p GfrF+Pt+eel+++yLk+k+ g++  + + i+e+d+yk+ePw+Lp +  +++++ ew+fF  + +      +++r+t +g W++tg d++++++ +++
  Cla021063  13 PIGFRFRPTEEELITHYLKNKILGHESLV-QYIREIDLYKYEPWELPeQsLFESDNYEWFFFRAHTS------KTKRTTGNGGWRTTGDDRPIKARgTNK 105
                89************************777.88**************954344555559999988766......5789******************96677 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++ ++k+Lvfy+gr+++++kt+Wv+hey+l
  Cla021063 106 VIATRKILVFYEGRSSDAVKTNWVIHEYHL 135
                89***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-457153IPR003441NAC domain
PROSITE profilePS5100545.43312155IPR003441NAC domain
PfamPF023656.4E-2213135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MASFTFPPHY LWPIGFRFRP TEEELITHYL KNKILGHESL VQYIREIDLY KYEPWELPEQ  60
SLFESDNYEW FFFRAHTSKT KRTTGNGGWR TTGDDRPIKA RGTNKVIATR KILVFYEGRS  120
SDAVKTNWVI HEYHLHPDRN IPYQRQFVVC RLKENAEEID VSTCDQDRQT SSVASHLKKK  180
GTQRPIQVAL KQMGNRSFSP CGIPHDNLLW XXXXXXQLAL ADFPSVNVNM QPIQAPPSEN  240
AVSLTEILNS IFVPDEYLDD ATSKMCESPW CSEPEPALMD FQLSSDNDGE VNNQLLQPKA  300
SKTELNFSEL LLNSVLVEDE NCDEVTSNNG IDSYNEEELE RMVYELQADI CRSDTDTDTT  360
FGFPAKEDEK HIEIVDLPQL SVTHSNNELK GEAGNKATKS GVSCCGSIGS TRNSFSYILT  420
TKRIDHKSSL PVIYVAKAFL GIIMLIMFAQ EVLLYRHSRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-321313516140Stress-induced transcription factor NAC1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022144269.11e-136NAC domain-containing protein 62-like
TrEMBLA0A1S3BM551e-112A0A1S3BM55_CUCME; NAC domain-containing protein 91-like
STRINGXP_008449087.11e-112(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2483433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.11e-30NAC domain containing protein 62