PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla021011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family ARR-B
Protein Properties Length: 675aa    MW: 74820.1 Da    PI: 6.69
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla021011genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like911e-28197250155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv+av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Cla021011 197 KPRVVWSVELHRKFVNAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 250
                79*******************.********************************8 PP

2Response_reg76.78.5e-26201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ + +l+++l++ +y +v+++ ++  al+ll+e++  +D+++ D+ mp+mdG++ll+     e++lp+i+++a+g+++++ + +  Ga 
     Cla021011  20 VLAVDDDPTCLLILETLLRRCQY-HVTTTNQAIMALKLLRENKnkFDVVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDPKLVMKGITHGAC 114
                   799********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
     Cla021011 115 DYLLKPVRIEELKN 128
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.0E-1631670IPR017053Response regulator B-type, plant
SuperFamilySSF521726.97E-3616142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.9E-4217157No hitNo description
SMARTSM004489.8E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.80619134IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.7E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.11E-2721134No hitNo description
PROSITE profilePS5129412.057194253IPR017930Myb domain
SuperFamilySSF466897.35E-20194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-30195255IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-26197250IPR006447Myb domain, plants
PfamPF002495.1E-7199249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
MTVEPRLDDP IDQFPTGMRV LAVDDDPTCL LILETLLRRC QYHVTTTNQA IMALKLLREN  60
KNKFDVVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DPKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVIRRKKFD PKDRMNSGNQ DRPDSETGEE AADPNGKFNK KRKDQNYNED  180
DDQDYGQEND DSSTQKKPRV VWSVELHRKF VNAVNQLGID KAVPKKILDL MNVEKLTREN  240
VASHLQKYRL YLKRISCVAN QQANMVTALS SADPSYLRIG SLSGIGNFHS LTGPPQFPNT  300
AYRSIPTTGM LGRLNSPACM GMHGLSSPGT VQLSNLNNSS NDQTTFQPIM LSGNRSGNIF  360
RGMPEPSEID QLQHVKHGTH ADSLSSAFDE RTVFPASIGL PNANMSSGTL SNPLLGLTND  420
PLISEVQHHE VNGGRKFGTP SSISVVSSNS DSSRPSLDNV RCTGDNWSNA VHSSRVHLNT  480
IPSSNLSNVA TSYHSQLRDN TTSALHIGNC LSDISSITSI STQSHDSRID SQRQAATTSN  540
RFDQMISKVP VQDWNDHKED SYYHTTMACS SSNSLIPVNG AAETLPKRLE NQNIIFSSSK  600
DFNVTSQANV LDHAMVEHDQ FKKSTMETSL MLKQGYLYDH QQKMQSRLSS SNCGSLEDIA  660
CAMMKQIVSS ELGIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-25193256164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452870.10.0PREDICTED: two-component response regulator ARR12-like
SwissprotA2X1N21e-140ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A1S3BUB40.0A0A1S3BUB4_CUCME; Two-component response regulator
STRINGXP_008452870.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-134response regulator 12