PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29247.4 Da    PI: 8.2586
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020900genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-19115169256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tk+q  +Le+ F++++ +s +++++LAk+l+L  rqV vWFqNrRa+ k
  Cla020900 115 RKKLRLTKQQSAILEDNFKEHSSLSPKQKQDLAKQLKLRPRQVEVWFQNRRARTK 169
                78889************************************************98 PP

2HD-ZIP_I/II118.53.7e-38115203190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rl+k+q+++LE++F+e++ L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk+++++lkeen+rL+ke +eL+ +
    Cla020900 115 RKKLRLTKQQSAILEDNFKEHSSLSPKQKQDLAKQLKLRPRQVEVWFQNRRARTKLKQTEMDCELLKKCCEKLKEENTRLQKELQELK-S 203
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.265111171IPR001356Homeobox domain
SuperFamilySSF466892.69E-18112179IPR009057Homeodomain-like
SMARTSM003891.9E-16113175IPR001356Homeobox domain
CDDcd000861.05E-16114172No hitNo description
Gene3DG3DSA:1.10.10.607.2E-18114177IPR009057Homeodomain-like
PfamPF000464.7E-17115169IPR001356Homeobox domain
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
SMARTSM003405.1E-18171214IPR003106Leucine zipper, homeobox-associated
PfamPF021831.2E-8171204IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MNRDCNTGLL LGLGRVSGDD SLGSLLPPEV ADVKKKLQVL KFDDILPSLT LGLSTVVVEK  60
SAATDELIQQ GCSGSPASSF SNSSGFKRER DSGGEEKEAE VYMKVGEEDE DGSPRKKLRL  120
TKQQSAILED NFKEHSSLSP KQKQDLAKQL KLRPRQVEVW FQNRRARTKL KQTEMDCELL  180
KKCCEKLKEE NTRLQKELQE LKSLKLTAPP FCMQLQAATL TVCPSCETSI CSGGGGGGGD  240
ASPPNTFSIG SKPHFLKFPF KHPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163171RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818612e-96LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132612e-96LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022935802.11e-130homeobox-leucine zipper protein HAT9-like
SwissprotP466031e-71HAT9_ARATH; Homeobox-leucine zipper protein HAT9
TrEMBLA0A0A0L3X31e-121A0A0A0L3X3_CUCSA; Uncharacterized protein
STRINGXP_004141416.11e-122(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22800.12e-44HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]