PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 563aa    MW: 62363 Da    PI: 4.3348
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020527genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-5291361128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat++gyWk+tgkd++v + + +
  Cla020527   9 LAPGFRFHPTDEELVSYYLKRKVSGKPFRF-DPISVIDIYKSEPWDLPgKsKLKSRDLEWYFFSALDKKYGNSSRTNRATEKGYWKTTGKDRPVRH-SAR 106
                579**************************9.99***************6347777888**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kktLv++ grap+g +t+Wvmhey+l
  Cla020527 107 TVGMKKTLVYHIGRAPRGARTNWVMHEYKL 136
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-617159IPR003441NAC domain
PROSITE profilePS5100557.289159IPR003441NAC domain
PfamPF023654.2E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MGRDSATSLA PGFRFHPTDE ELVSYYLKRK VSGKPFRFDP ISVIDIYKSE PWDLPGKSKL  60
KSRDLEWYFF SALDKKYGNS SRTNRATEKG YWKTTGKDRP VRHSARTVGM KKTLVYHIGR  120
APRGARTNWV MHEYKLTDEE MGKIAIVQDA FVLCRIFQKS GTGPKNGEQY GAPFIEEEWE  180
ENEELAVVPG DDQVADEFLG GGGVCVEGDD VVENVDEGIL SESAPPPPFN FYYGETSNSV  240
EQSDYIEDDQ KPAVGVCETS ELPDGQKFFV LPDECGLHDR LVKHEYLAEP SNDADTNVAD  300
EVDAGDMDGR YVLNEAFFST SDNLSFSDEL LLESNELSNP TESDPAAFDV LEEYLTFFDA  360
DGDNADMSFD PSEILGSGSP VPDQAVLSEV AGGATEDESA SKHTADLRYD NEASSSSMQK  420
PEDPKAESDI KYPFLKHTSH MLGSIPSPFA SQFTSKDAAI HLNSTPQASS SVRVTAGMIV  480
IRNMALNGDE VNNLYGKNSD LNFIYLYGIV EGNIDSSQSL PTAGVNSSKS EPLISRYFLH  540
FFILFWVLIL SVSFKVGRCI HSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-47415910168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011655859.10.0PREDICTED: NAC domain-containing protein 78
SwissprotQ84K001e-155NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A0A0KRG60.0A0A0A0KRG6_CUCSA; Uncharacterized protein
STRINGXP_008446811.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-145NAC domain containing protein 53
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]