PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 505aa    MW: 57441.5 Da    PI: 6.1088
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020203genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.26.6e-901154933373
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                + Ll+ A a+ +++++++q+l++ l+el sp+gd  q+la+yf++++ +r+++s+ + y +l + +++++  ++   ++  f evsP+++f+h++ N  I
  Cla020203 115 TILLQTAIAIVDNNTSRIQQLMWMLNELGSPYGDIDQKLAFYFLQGMFSRVTDSGAKWYGTLVAASEKRSCFESMRRMVLKFEEVSPWMTFGHVASNGWI 214
                5799********************************************************998777775444444444445******************* PP

       GRAS 103 leavegeervHiiDf..disqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvlvak.rledleleeL 194
                +ea++ge+++HiiD+  + s ++QWp++++aLa++++++p+l +T +++++s+     +k+ ++e+ +rL+kfA+ +gv+f+f+++ +  +++++++ +L
  Cla020203 215 MEALQGEKKLHIIDMagNSSFCTQWPTFIEALATQSDQTPHLTLTLLVAAKSDgtiraHKKLVKEISRRLEKFARLMGVSFKFKPIFHYgDVSQFDFTHL 314
                ***************555889***************************999989***9999************************95555********** PP

       GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                 +k++EalaVn++ +l ++     +l+++rd +++l++sl+P++++vve+ead+   ++ +F++++ e+l+++   fdsl+ ++p++++e+ ++Er+  g
  Cla020203 315 GIKHDEALAVNCAGALRSVA----PLHNRRDFLISLFRSLRPRIITVVEEEADLdphSGVDFVKHIQECLRWFRLYFDSLDRSFPTATDEQFMLERA-AG 409
                ****************9997....999999*********************9973225559************************************.** PP

       GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee...sgslvlgWkdrpLvsvSaW 373
                r++v+++a   ae++er+et+++W +rl + GFkpv++se++++++++l+r++k dg+++ +     + ++l Wk++p+v++SaW
  Cla020203 410 RAVVDLLARVPAESVERRETAARWARRLYDGGFKPVSFSEDVNDDVRALVRRYK-DGWTMTDGdgsGAGIFLAWKGQPVVWASAW 493
                ******************************************************.9999986522133456************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.74687472IPR005202Transcription factor GRAS
PfamPF035142.3E-87115493IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MDTLFRSVND LESSNQHSYN NSSSSSKNCS DQNHYYHLQK PQSEECFNNL FMEEEDHFSA  60
SSSLDHNHHH QLPQFQCSTT GTSTTSTGTT APRDEWFSSF TQELNFEFSD DWASTILLQT  120
AIAIVDNNTS RIQQLMWMLN ELGSPYGDID QKLAFYFLQG MFSRVTDSGA KWYGTLVAAS  180
EKRSCFESMR RMVLKFEEVS PWMTFGHVAS NGWIMEALQG EKKLHIIDMA GNSSFCTQWP  240
TFIEALATQS DQTPHLTLTL LVAAKSDGTI RAHKKLVKEI SRRLEKFARL MGVSFKFKPI  300
FHYGDVSQFD FTHLGIKHDE ALAVNCAGAL RSVAPLHNRR DFLISLFRSL RPRIITVVEE  360
EADLDPHSGV DFVKHIQECL RWFRLYFDSL DRSFPTATDE QFMLERAAGR AVVDLLARVP  420
AESVERRETA ARWARRLYDG GFKPVSFSED VNDDVRALVR RYKDGWTMTD GDGSGAGIFL  480
AWKGQPVVWA SAWAPVELDG EKTHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-2214749337374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649340.10.0PREDICTED: protein SHORT-ROOT-like
SwissprotQ9SZF71e-154SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A0A0LLY30.0A0A0A0LLY3_CUCSA; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-145GRAS family protein