PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla020073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 206aa    MW: 22431.9 Da    PI: 7.6329
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla020073genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.48.7e-42551541100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r+da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++e
  Cla020073  55 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKFLQELPESQRTDAVSSMVYEANARLRDPVYGSAGAICQLQKQVSELQAQLAKARAE 154
                7**********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6854155IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-4255152IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MAYVAKCSNS PPTPITVPNP LSFSPMSSSS TATNFASPPT SQPSSPPPPA VVLSPCAACK  60
ILRRRCVEKC VLAPYFPPTE PLKFTIAHRV FGASNIIKFL QELPESQRTD AVSSMVYEAN  120
ARLRDPVYGS AGAICQLQKQ VSELQAQLAK ARAEVANMQQ QQANLLALIC MEMRQSPEPV  180
WPPQLIDTAC FLDDATLSSP WEPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132648e-92LN713264.1 Cucumis melo genomic chromosome, chr_10.
GenBankLN6818968e-92LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143693.11e-115PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0KNK91e-109A0A0A0KNK9_CUCSA; Uncharacterized protein
STRINGPOPTR_0008s04350.14e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-60LOB domain-containing protein 1