PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019112
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Nin-like
Protein Properties Length: 319aa    MW: 36588.2 Da    PI: 4.726
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019112genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.63.7e-26148198252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                +k +s + +s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  Cla019112 148 SKMLSRKAISEYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 198
                578999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.575134219IPR003035RWP-RK domain
PfamPF020422.2E-21151198IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDATWGPKCE VMVFEDSFPL SCQLSPLPFR SSYNNYSGLD WNCNFGLQDN IFEVVPLLES  60
FPNNDSFLES KDIVPINTFI SEDGVGIWSE MENGIFGFVE EEPVLLLEGE DGGGNEENRE  120
VMKKGKRKYL RSENSKNNGS YSTSSSSSKM LSRKAISEYF YMPITQAAKE LNVGLTLLKK  180
RCRELGIRRW PHRKLMSLQT LIKNVKEIEK GEGEGNGENK LKNVLEILEN EKKLMEERPD  240
LQLEDNTKRL RQACFKANYK KRKLSGIIFN NNNNIINEDN SQCFSSSTTI HDRDEEDDEE  300
MKYLLSDCSF SSTNCTLFM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818133e-71LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132563e-71LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453676.11e-122PREDICTED: protein RKD1-like
TrEMBLA0A1S3BWU61e-120A0A1S3BWU6_CUCME; protein RKD1-like
STRINGXP_008453676.11e-121(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-38RWP-RK domain-containing protein