PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019099
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 362aa    MW: 41116.6 Da    PI: 8.4409
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019099genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-55131391129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL +kv ++++++ ++i +vd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdk++++ +++lv
  Cla019099  13 LPPGFRFHPTDEELISHYLFEKVMDSSFSC-RAIGDVDLNKSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKDIYR-GKSLV 110
                79****************************.89***************888999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrle 129
                g+kktLvfy+grapkgek+dWvmheyrle
  Cla019099 111 GMKKTLVFYRGRAPKGEKSDWVMHEYRLE 139
                ***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-649163IPR003441NAC domain
PROSITE profilePS5100559.56713163IPR003441NAC domain
PfamPF023651.0E-2814138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MAAVVNKQDH LELPPGFRFH PTDEELISHY LFEKVMDSSF SCRAIGDVDL NKSEPWDLPW  60
KAKMGEKEWY FFCVRDRKYP TGLRTNRATE AGYWKATGKD KDIYRGKSLV GMKKTLVFYR  120
GRAPKGEKSD WVMHEYRLEG KLSALNLPKT AKNEWVICRV FQKNSSGKKV DISGMSKLGS  180
FGNDFGHSIL PPLTDSSPFN GETKRPVVQL PNNVPCFSIA MDSQRKLEPM ASSYNTSLFS  240
VIPNPIDSFP RNPHSNSMYS PPNQTFSVPP NLQFQNSVLL QEQQSLLRAL IQNVNDGNTR  300
ESFKPERDKI SISQETCLTT DVNNEISSVF PNLEMGRRPF DNSQEAPPAP MAPIDLDGFW  360
NY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-531016917174NAC domain-containing protein 19
3swm_B1e-531016917174NAC domain-containing protein 19
3swm_C1e-531016917174NAC domain-containing protein 19
3swm_D1e-531016917174NAC domain-containing protein 19
3swp_A1e-531016917174NAC domain-containing protein 19
3swp_B1e-531016917174NAC domain-containing protein 19
3swp_C1e-531016917174NAC domain-containing protein 19
3swp_D1e-531016917174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-165LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-165LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011660158.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-143NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A0A0LPF00.0A0A0A0LPF0_CUCSA; Uncharacterized protein
STRINGXP_004154965.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-146NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]