PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family SBP
Protein Properties Length: 550aa    MW: 60078.9 Da    PI: 7.6567
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019041genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.53.5e-42175251278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                Cqv gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Cla019041 175 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 251
                **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33169236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.385172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-39173252IPR004333Transcription factor, SBP-box
PfamPF031105.1E-32175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MESWSYVSEG KGCMSDEMNS PTSSLARNKD SLLGWEFKNP CSFGSTMLPT SQQVDNQGFG  60
ELVFPEMIGK QLPDNSVCDI LSSKVVGGRF LNPAMNSSNA FLGEDESTSK LSGSIVDSSS  120
RDSSFIDLKL GRFADQRDAH GYKFFKGGPI LSSSESSMPS KRVRASGLNS QTYYCQVYGC  180
NKDLSSSKDY HKRHKVCEVH SKTAKVIVNG IEQRFCQQCS RFHLLAEFDD GKRSCRKRLA  240
GHNERRRKPQ VAINSGRAGR FLQSYNGSRP QGTALTATSF ICQELLPNGL LHPEKYGTSD  300
WCRTVKIEDK NEYMPLSAVH VPSGHLHSKS LFSPYDIETQ VPPFHDNGPN ASTTNMFKEN  360
SNQYPLSVGG VNSSSRSYFH NPSLGSEYFS VFSAASTDRL SGLSDSGCAL SLLSSQTQNS  420
STHSSGIPIG RPLVLLDGQN HYSMSQLSEK LMGVSSQVSV SGVSNKFESS GLNASEGCTL  480
GPISTPDTSD AVNLEITNRI FHGSNLTDPG EGGPTIDLLQ LSSQLQRVEH QRQAMQVKQE  540
SNAFCCLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291752481184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022987111.10.0squamosa promoter-binding-like protein 6
RefseqXP_022987112.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A0A0LRX60.0A0A0A0LRX6_CUCSA; Uncharacterized protein
STRINGXP_004138332.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-47SBP family protein