PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 279aa    MW: 32054.7 Da    PI: 7.8879
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018880genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-18146200256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq + Lee F+ + +++ ++++ LA++l+L++rqV vWFqNrRa+ k
  Cla018880 146 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTK 200
                788899***********************************************98 PP

2HD-ZIP_I/II118.24.6e-38146234190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rlskeq++lLEesF+ +++L+p +K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +
    Cla018880 146 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTKLKQTEVDCEFLKKCCERLNEENRRLKKELHELR-S 234
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.17E-17134203IPR009057Homeodomain-like
PROSITE profilePS5007117.2142202IPR001356Homeobox domain
SMARTSM003893.8E-15144206IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-16146200IPR009057Homeodomain-like
PfamPF000461.9E-15146200IPR001356Homeobox domain
CDDcd000865.43E-14146203No hitNo description
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
SMARTSM003408.4E-19202245IPR003106Leucine zipper, homeobox-associated
PfamPF021838.5E-9202235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MADHQDEVCN ISWLSLGLGF GEYVPKKMQK INNKQQQQQQ QQLSFTLIPK EELGINNNDD  60
DDANNNINME IDDEANSSEE DDHHLMKRIR SNNNIVNYDQ DSSFGIRRSS SDHHHHQYTN  120
NNNNIITTNH NYKGISSSSG SELRERKKLR LSKEQSTLLE ESFKLHTTLN PAQKQALAQQ  180
LNLKTRQVEV WFQNRRARTK LKQTEVDCEF LKKCCERLNE ENRRLKKELH ELRSLKLGAS  240
QLYIQLPKAA TLTICPSCDK ITRTAAANAA AVDANSPPQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143149RERKKLR
2194202RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269|PubMed:10477292, ECO:0000269|PubMed:11260495, ECO:0000269|PubMed:8449400}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269|PubMed:8106086}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818137e-87LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132567e-87LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150745.11e-144PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotQ054668e-54HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A0A0M0121e-143A0A0A0M012_CUCSA; Uncharacterized protein
STRINGXP_004150745.11e-143(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.14e-43homeobox protein 2
Publications ? help Back to Top
  1. Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I
    Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development.
    Plant Signal Behav, 2014.
    [PMID:23838958]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Francisco M, et al.
    Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense.
    Front Plant Sci, 2016. 7: p. 1010
    [PMID:27462337]
  4. Müller-Moulé P, et al.
    YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance.
    PeerJ, 2016. 4: p. e2574
    [PMID:27761349]
  5. Ivarson E, et al.
    Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre.
    Front Plant Sci, 2016. 7: p. 2032
    [PMID:28119714]
  6. Kasulin L, et al.
    A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina.
    Mol. Ecol., 2017. 26(13): p. 3389-3404
    [PMID:28316114]
  7. Singh M,Gupta A,Singh D,Khurana JP,Laxmi A
    Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth.
    Sci Rep, 2017. 7(1): p. 16101
    [PMID:29170398]