PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018713
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family ARR-B
Protein Properties Length: 678aa    MW: 74071.1 Da    PI: 6.7601
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018713genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like29.51.7e-09211240131
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPkt 31 
                kpr++W+ eLH++Fv+av+qL G e+ t k+
  Cla018713 211 KPRVVWSVELHRKFVSAVNQL-GLENSTRKQ 240
                79*******************.999999876 PP

2Response_reg84.33.7e-28261341109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l+k +y +v++++++ eal++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ e++ + +  Ga 
     Cla018713  26 VLAVDDDPICLKVLETLLRKCQY-HVTTTKQSIEALKMLRENRnkFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDTELVMKGIAHGAC 120
                   799********************.***************999889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
     Cla018713 121 DYLLKPVRIEELKN 134
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.5E-1321677IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.3E-4423158No hitNo description
SuperFamilySSF521727.4E-3823148IPR011006CheY-like superfamily
SMARTSM004481.7E-3424136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011045.12925140IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.43E-3027140No hitNo description
Gene3DG3DSA:1.10.10.601.5E-9208260IPR009057Homeodomain-like
SuperFamilySSF466893.4E-5209259IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MTVEGHSVAA VGDDGATDHF PIGMRVLAVD DDPICLKVLE TLLRKCQYHV TTTKQSIEAL  60
KMLRENRNKF DLVISDVNMP DMDGFKLLEL VGLEMDLPVI MLSAHSDTEL VMKGIAHGAC  120
DYLLKPVRIE ELKNIWQHVI RRKKLEPKAK NKVPNQDKVR NGGNEGEQGF SPTNNADNAK  180
FNRKRKDQDD DEDEEGKENG LDCDDPSNQK KPRVVWSVEL HRKFVSAVNQ LGLENSTRKQ  240
NENKSVHVVL QKYRLYLKRI SNVASQQANM VATFGSKDGT YMRLGSLDGY GELHGFAGSG  300
RLPNSSLSSY SPVGMLGRLN SPAGMSLRGI TSSGLIQQSS QNLNCAINNL GKLQPTTMLP  360
PNQTTNLLQG IPTSLEIGQL QHSKSTTPIG DFNTMNETSG FGVPNSFSDT RANIGNSNYS  420
VSPAPLMLQG TMPTYGNQTS LRVDPLNGET FDIDIGGSNF LDPDPSSGNW QGAAQHLSRF  480
STTSLTPNEA YSNDQLHAMN SSISSGPSTI GNISVDFSSR SAVSAPLLDS RDVQCQGGVV  540
GSVMQAVNTM PKQRWEEHKH DYSRNVQHNL GAINSLVSSN GTLTPLSQSY NQNGLVCDRK  600
VGSSLIVPSS AAPLSFPQQS MVEKLGLNTK TNADGNYLLN QTKSHDGSIQ GNFESLDDIM  660
NSIMKRVKFH APFVDQMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jte_A1e-13251455126Response regulator receiver protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818080.0LN681808.1 Cucumis melo genomic scaffold, anchoredscaffold00012.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443880.10.0PREDICTED: two-component response regulator ARR12 isoform X2
TrEMBLA0A1S3B9520.0A0A1S3B952_CUCME; Two-component response regulator
STRINGXP_008443879.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-112response regulator 12