PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family SBP
Protein Properties Length: 571aa    MW: 63016.4 Da    PI: 7.8789
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018546genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1339.9e-42174250278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                Cqv gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Cla018546 174 CQVYGCSKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQV 250
                **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-32169235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.334171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-39172252IPR004333Transcription factor, SBP-box
PfamPF031102.6E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MESWNYGSQG KGFLSDEMNS STNSPLRSKY SLLGWEFKNP CSFGDNMLLS SGGQHVEDQS  60
FGELEFPQMV GKQLPVDSVS DVLNTKIDGA RNLNLVLPTF HGEEESTSKL SGSIVDSNNR  120
DSSLIDLKLG RFIDQGDAHS SKYSKRAAIS SSTESSTSQK KMRSQGVNVQ TAFCQVYGCS  180
KDLSSSKDYH KRHKVCEVHS KTAKVIVNGI EQRFCQQCSR FHLLVEFDDG KRSCRKRLAG  240
HNERRRKPQV SFHSGRAQRL LQPYNGIGDG RFQEKTLTAT SFICKDILSS GLYYPEKLGE  300
NDWCKRIKVE GKNDYNSMSA TSLGNRHLNV KSPLLPYDFE VQIPSFQENG TSTAPTINML  360
SETTCQYSHN VGGSHIDTHP LFHHTTLPSE DFGVYDAAST IQGLSGIPDS GCALSLLSSQ  420
SQSASNHPSI VHIPRAFIMS ESQSNYSMSE LSEKFMGVSP QASSTGISSK FASGMSEAQM  480
GPIPTCESSN RTVTFQIPDR VLHRSGLANP KANLSYEGTP TIDLLQLSSQ LQRVEHQRHS  540
VQVLGSSTDK YNGIYKYDSV GRLALLRVCL D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291732471084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453118.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_016899321.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
TrEMBLA0A1S3BWK90.0A0A1S3BWK9_CUCME; squamosa promoter-binding-like protein 12 isoform X1
STRINGXP_008453118.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-50SBP family protein