PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 356aa    MW: 40915.2 Da    PI: 10.1997
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018434genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.5e-31178231255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rF++ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cla018434 178 PRMRWTSSLHARFIRAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 231
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-28175232IPR009057Homeodomain-like
SuperFamilySSF466893.94E-15176232IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23178231IPR006447Myb domain, plants
PfamPF002493.0E-7179230IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MLEKGIIVPD LSLQISPPKS NPSPSFDIWQ RTQVPQVDTE LSLSNNSTSA VDVSADRFRP  60
IRGIPVYNNG LFSSSRYFNR NQPTSSSSPP PPPCLSFRSF QQQQQQEAVG RYNGITMEGL  120
RNQQQNIINH QNQNQNQFIF QNQESLHFGV SDFSCNYNNS RSRLLIPRIQ SRRNSRAPRM  180
RWTSSLHARF IRAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKNTDKQTA  240
SSEGSGEEDF LPATPTPHHE ANCLLNHRRG FSNASLEPDV NGSTPSINNH SNSSRLIFFF  300
PLSINFFLFY VSWFGTICFF LSFFLSFFYF YFYLFIFFIT IGKKKKKSIF LGYRSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-17179233458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-17179233458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-17179233357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-17179233357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-17179233357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-17179233357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-17179233458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-17179233458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-17179233458Protein PHOSPHATE STARVATION RESPONSE 1