PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla017995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Trihelix
Protein Properties Length: 304aa    MW: 35539.1 Da    PI: 7.3501
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla017995genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.12.6e-2454136186
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                +W+ qe+++ +++r e+++++ ++k++k lWe  ++km+e+gf+rs++qCk+kw+nl +ryk ++++e +    s++++p++++l+
  Cla017995  54 QWSIQETKEFLTIRAELDQTFMETKRNKLLWEITASKMKEKGFNRSAEQCKCKWKNLVTRYKGCETMEPEI---SRQQFPFYTELQ 136
                7********************************************************************97...55679****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122035.47E-2253118No hitNo description
PfamPF138372.6E-1954138No hitNo description
PROSITE profilePS500906.92255111IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEGHNPHPHP HPHPLIQLHQ QQQIQLPPPP PHLHQSLAVS ADQTTATAAD RFPQWSIQET  60
KEFLTIRAEL DQTFMETKRN KLLWEITASK MKEKGFNRSA EQCKCKWKNL VTRYKGCETM  120
EPEISRQQFP FYTELQAIFG ARMQRILWAE AESGGSGSKK KTLPLSSDDD EENDDSDGDG  180
GEAKVSGRKR KKVKGMGGTT TGGGEGSGKS SINDLKEMLE DFMNQQMQME VQWREAFEAR  240
EKERQMREME WRRNMEALEH ERIMLERRWR EREEQRRMRE EVRAEKRDAL ITALLNKLRR  300
DDHI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1187191RKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM8548200.0HM854820.1 Cucumis melo subsp. melo clone 00002, complete sequence.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137715.21e-142PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW02e-73TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0A0LF981e-142A0A0A0LF98_CUCSA; Uncharacterized protein
STRINGGLYMA18G43190.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.14e-55Trihelix family protein