PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla017553
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 351aa    MW: 38288.9 Da    PI: 6.2458
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla017553genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.11.3e-17199250556
                SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++k+q   Lee F+++ +++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  Cla017553 199 LRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTK 250
                5789**********************************************98 PP

2HD-ZIP_I/II126.61.1e-40197286292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  kk+rlsk+q+++LEesF+e+++L+p++K +la++L+lqprqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+ke +eLr +lk
    Cla017553 197 KKLRLSKQQSAFLEESFKEHTTLNPKQKLALAKQLNLQPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCETLTEENRRLQKELQELR-ALK 286
                  9*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.1E-17189253IPR009057Homeodomain-like
PROSITE profilePS5007116.261192252IPR001356Homeobox domain
SMARTSM003891.7E-14194256IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-17197250IPR009057Homeodomain-like
CDDcd000861.41E-15197253No hitNo description
PfamPF000464.2E-15199250IPR001356Homeobox domain
PROSITE patternPS000270227250IPR017970Homeobox, conserved site
CDDcd146860.00763245284No hitNo description
PfamPF021839.3E-11252286IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-25252295IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MELGLSLGDH PPSNSNKPFG FLSKPLSSSS SSSLMALGFC VGLIGHHSAS ASASASASAS  60
ASLQDDEEDD EDDDNDQKTV LLGSASGSDP PVQLDLLPLA PVPRSSSSSL PFPWLSHHLM  120
AEVGSSEGGE RVELDVNRAA ETEDSRVSCF QMEFGARNGG GIKRKRSWEM EMETERGGCS  180
RMSDDDQDHN ASAAAPKKLR LSKQQSAFLE ESFKEHTTLN PKQKLALAKQ LNLQPRQVEV  240
WFQNRRARTK LKQTEVDCEY LRRCCETLTE ENRRLQKELQ ELRALKTSQP FYMQLPATTL  300
TMCPSCERVA ATTTTTASVP TKTATPAPSS ALCLANKPKI LPFPHLHQAA S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1244252RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-101LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-101LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443033.11e-146PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466657e-86HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1S3B7U41e-144A0A1S3B7U4_CUCME; homeobox-leucine zipper protein HOX11
STRINGXP_008443033.11e-145(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-65homeobox from Arabidopsis thaliana