PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla017118
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 171aa    MW: 18785.9 Da    PI: 7.762
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla017118genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.21.6e-4410108199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC +dCv+apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  Cla017118  10 PCAACKFLRRKCLPDCVFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARMKDPVYGCVGAISILQRQVIKLQKELDATNA 108
                7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.6269110IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MSSSTYSNSP CAACKFLRRK CLPDCVFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVQP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS ILQRQVIKLQ KELDATNADL IRYACSEIPT  120
PSPSSSSQYA RRSSSTSHEG SSSTSSYGHY YSGLYFSPWS NNNNGPCGDG H
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141196.11e-125PREDICTED: LOB domain-containing protein 25-like isoform X1
SwissprotQ8L8Q31e-69LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0A0LI151e-125A0A0A0LI15_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s35280.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-70LOB domain-containing protein 25