PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla016743
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 516aa    MW: 56121.6 Da    PI: 6.9857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla016743genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.9e-32298353156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cla016743 298 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 353
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355295355IPR017930Myb domain
SuperFamilySSF466891.02E-16295356IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28296356IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-26298353IPR006447Myb domain, plants
PfamPF002499.4E-7300351IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MPSPPELSLD CKPHSYSMLL KSFVSDNQVA APTTTTTTST NTQDHQQQHS SQNQLEDLLS  60
RLEAERLKID AFKRELPLCM QLLTNALETS RQQLQGCRVN SNIHDQENGQ KPILEEFIPL  120
KQTTSEGSET LSNISDKANW MTSAQLWSQT TNNISNDETK PNLSSSKEQQ QQPIDHHQIG  180
LIPKLQRNNN NNHNHNNGGA FLPFSKDRIL QNSTSSSSHL PDLALAAATA ATNFGDNDGN  240
KCGNSNHHQP ENGNLVTGKV NLGGEGQIIT NSSNNNNNST VVANNNNTTN STNQTHRKAR  300
RCWSPDLHRR FVNALQMLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY RLHTRRPSPS  360
PQAAGAPAPQ LVVLGGIWVP PEYATAAAAA AHGGAQALYG PHPTTYCAPP PVHQDFYPPP  420
PLPHHQLHHQ HALHQQLHMY KAAATAQAQS SPESDGRGNG DRSESIEDGG KSESGSWKVE  480
SGGENNGGGG ERKGNLAALR QEAGDESNGS EITLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14298351154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14298351154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14298351154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14298351154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14298351255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818471e-169LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
GenBankLN7132591e-169LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457979.10.0PREDICTED: putative uncharacterized protein DDB_G0271606
TrEMBLA0A1S3C6R40.0A0A1S3C6R4_CUCME; Uncharacterized protein
STRINGXP_008457979.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.19e-98G2-like family protein