PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla016452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family TCP
Protein Properties Length: 372aa    MW: 41900.2 Da    PI: 9.2502
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla016452genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP149.71.9e-461082443135
        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg.......kaaksaa 95 
                +kkdrhski+T++g+RdRRvRls+++ ++fFdLqd+LG+dk+skt++WLl+++ +aikelt+t ++++  +   ss+ + + +s++       +a+k   
  Cla016452 108 VKKDRHSKIYTAQGLRDRRVRLSIDISRKFFDLQDMLGYDKASKTLDWLLTKSRKAIKELTKTRNNHHITS---SSKYNFDDDSEEcevisndEAEKIML 204
                79*************************************************************66666222...33333333333344444423333344 PP

        TCP  96 kskksqksaasalnlakesrakarararertrekmriknk 135
                 +++s+k+ a +  +akesrakarararert+ekm ++++
  Cla016452 205 AKSSSKKNLAFHDVVAKESRAKARARARERTKEKMIMNQQ 244
                56666666666788899*******************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-41108241IPR005333Transcription factor, TCP
PROSITE profilePS5136935.65109167IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137012.537221238IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MFSSTNNLHL FPLQQYFPSS SSSSYHHHLV APPPLSPSHH PEPVYLGPQD PVLSGVGGPF  60
LQVLPNQEDQ GRMKNEHQEV VLMSQNNGNS QCFSSSGLNN FLTKKTSVKK DRHSKIYTAQ  120
GLRDRRVRLS IDISRKFFDL QDMLGYDKAS KTLDWLLTKS RKAIKELTKT RNNHHITSSS  180
KYNFDDDSEE CEVISNDEAE KIMLAKSSSK KNLAFHDVVA KESRAKARAR ARERTKEKMI  240
MNQQFRSPPL PLPPSSLPPP PVSSSSSSIV QKAIVSSDQE SNIIGIMWKP SPMITSSSGY  300
QKNLVISKGD SYYNNCNNFY FPSNLPPNWD INIDSFARPQ PGYCTIANID SLPEFQVCAK  360
PWDTCSNNQH LH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A6e-14114167154Putative transcription factor PCF6
5zkt_B6e-14114167154Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0093032e-78LC009303.1 Cucumis melo CmTCP1 gene for TCP transcription factor, complete cds, cultivar: Fuyukei 1.
GenBankLN6818892e-78LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132632e-78LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656282.11e-153PREDICTED: transcription factor DICHOTOMA-like
TrEMBLA0A0A0KSL11e-151A0A0A0KSL1_CUCSA; Uncharacterized protein
STRINGXP_008459708.11e-111(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17383294
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-30TCP family protein