PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 287aa    MW: 31941.7 Da    PI: 5.0489
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015578genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.46.7e-40311301100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ e+e+am+++++++++r  dPv G++++i++lq+q+e +kael+ + ++
  Cla015578  31 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKNLDPFEKEEAMRTIIFQSDVRSVDPVGGCYRIIRDLQRQIEYSKAELEIVLHQ 130
                7*********************************************************************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3430131IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-3731126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSPINHHQHF SKSTSAAVTT TTSSTTTTTQ ACAACKYQRR KCAPDCILAP YFPHDRQRQF  60
LNAHKLFGVS NITKIIKNLD PFEKEEAMRT IIFQSDVRSV DPVGGCYRII RDLQRQIEYS  120
KAELEIVLHQ LAICKQQAAA AAAAAAAAAA ILEADPMSGY GGIEHQFVEG YEGEGFVVGE  180
NENGESLEDQ DVEVWGIQDS CSSLQLKQAG SVHDFHDIKI DTNNNHLQQQ LKFQHDRHPD  240
LVHQSEEPML KMDNVILKED SDPIQQAQDQ ELKGAVDTLF TFPACDT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462351.11e-164PREDICTED: LOB domain-containing protein 22
TrEMBLA0A0A0K9M31e-165A0A0A0K9M3_CUCSA; Uncharacterized protein
STRINGGLYMA07G01170.27e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-51LOB domain-containing protein 22