PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 518aa    MW: 58104.1 Da    PI: 7.4723
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015549genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS174.86.6e-541614192247
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                ++lL  cA a+ +gd++++++lL+ l+elasp+gd+++Rla + ++ALa++l++  s s+ +++++p + ++++      +l  f+evsP++ f + +aN
  Cla015549 161 EQLLNPCASAIVKGDATRVHHLLCVLQELASPTGDANHRLADHGLRALAHHLSSnsSFSSYSSTVTPVTFASTDPRFFQRSLIKFHEVSPWFAFPNNIAN 260
                689*************************************************99656677777788888887666666666666**************** PP

       GRAS 100 qaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlvakr 185
                + Il  +++e    + +Hi+D+++s+G+QWp+Ll+aL+ R+ ++pp +R+T++++  ++               ++ +rL +fA++l++++++n l  ++
  Cla015549 261 SSILHILSEEpnrpRNLHILDIGVSHGVQWPTLLEALTRRSgGPPPLIRLTVIAPTVEHdqntetpfsIGPPGDNISSRLLSFAKSLNINLQINRLDNHS 360
                *********99998999************************55566*******9987777776777666667899********************9999* PP

       GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqead 247
                l +l+ + ++  p+E l+V+ +++lh+l    ++ ++er e+L+ +++++Pk v+++e+++ 
  Cla015549 361 LRSLNSQVINKFPDEILIVCAQFRLHQLK---HCAPDERFEFLQNLRKMEPKAVILSENNMA 419
                ****************************8...88888999*******************986 PP

2GRAS47.23.8e-15421510282374
       GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                r + Er++++ e+ +++++ g++    +e+++kW er+++aGF+   + e++ ++a++ +r+++ ++++rvee++g++ l Wk++p+ ++S W+
  Cla015549 421 RESEERRVMEGEAAKALTNDGEM----NEEKGKWCERIRNAGFERKIFAEDTIDTARASMRRYDnNWEMRVEEKDGCVGLWWKGQPVSFCSLWK 510
                7788999**************99....9999*********************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098529.866134518IPR005202Transcription factor GRAS
PfamPF035142.3E-51161419IPR005202Transcription factor GRAS
PfamPF035141.3E-12421510IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MTIEETGPNH PSDHILDWLE DSVPFFSPFL DETNNSCSLN CYQWWGENQD TGEDLINGCL  60
SNSPTTVSTR LPNTPTSHHL TPSELTKKRK APDDSVHKKS QTHQNPRKNQ NNQSKTGADK  120
GSGAVEGVTV MKKSIGNKKN SSKSTGNNNN NGSNREGRWA EQLLNPCASA IVKGDATRVH  180
HLLCVLQELA SPTGDANHRL ADHGLRALAH HLSSNSSFSS YSSTVTPVTF ASTDPRFFQR  240
SLIKFHEVSP WFAFPNNIAN SSILHILSEE PNRPRNLHIL DIGVSHGVQW PTLLEALTRR  300
SGGPPPLIRL TVIAPTVEHD QNTETPFSIG PPGDNISSRL LSFAKSLNIN LQINRLDNHS  360
LRSLNSQVIN KFPDEILIVC AQFRLHQLKH CAPDERFEFL QNLRKMEPKA VILSENNMAW  420
RESEERRVME GEAAKALTND GEMNEEKGKW CERIRNAGFE RKIFAEDTID TARASMRRYD  480
NNWEMRVEEK DGCVGLWWKG QPVSFCSLWK LGIKSNAV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141813.10.0PREDICTED: nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A0A0KCK60.0A0A0A0KCK6_CUCSA; Uncharacterized protein
STRINGVIT_09s0002g01190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-137GRAS family protein