PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla015142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 570aa    MW: 64666.7 Da    PI: 4.8968
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla015142genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS272.11.7e-832095682374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev..sPilkfshltaN 99 
                 ++L+++Ae v  +++ +a++lL+r + +as++g+++qRl++yf++AL++r+ r++ +++     ++++    +ee++ ++++  +   P+ ++ hlta 
  Cla015142 209 AHVLFAAAEKVGYHQFDRASRLLQRCEWTASSYGNAVQRLVFYFAKALRKRIERQTGRVS----IEDSK----EEEIN-FEALKGCmkLPFQQVMHLTAV 299
                799***************************************************333222....22222....22222.2333333116*********** PP

       GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                qaI e v+  ++vH iD++i  G++W a++q+L  s++ +   l+iT+v+    ++ + +e++g+ L+++A++l++pf+f++++++++ +++ e ++++ 
  Cla015142 300 QAIFEHVKMTTKVHLIDLEIRSGVHWSAFMQSLVdSKEIPIKLLKITAVVT---DKIHLIEQVGKWLENVADSLNIPFSFKPILVSDMMEIKEEVFETED 396
                **********************************66778888*********...568889**************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++a+ + l l r+ ++++sle+    +++++++l+P ++vv+e ea++n +sF++rf+eal + ++ fd+l++ +++++e r+k+E++  g  i+n+v
  Cla015142 397 DEMVAIYCPLVLRRMISRPGSLEN----LMRVIRNLNPSIMVVSEIEANYNLPSFVNRFIEALFFTASYFDCLKTCIGEDDESRRKMEAF-CGVGIENAV 491
                ************************....**************************************************************.8******** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                a eg++r++r  + e Wr+ ++++ +++++ls++  +qakl+ + ++ ++  ++e+++++l+ gWk+ p++s+SaW+
  Cla015142 492 ASEGSDRVARSVKIEVWRAFFGRFRMEEIELSDSCFSQAKLVPKGFAfGNFCSLEKNHKCLIVGWKETPIISISAWQ 568
                ***********************************************777789***********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.451182547IPR005202Transcription factor GRAS
PfamPF035145.9E-81209568IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MADDFFSFTP FDFNGSQAGT LVPSNGIHEK QGTKEDDCPF RMEEFGDFPE NQSGFYQQDI  60
PKIGDETNYE HPNSNCLILD DLLFSNDFTI SELIQEKSKT ISENMGADSF SLNPSKPVWN  120
PCLESLQLLN SYGGKVKRIK GTIVNKRGGG DGASEENKTL STEEILRVAG ARYVHIFPEG  180
HDEFYMATHP CDFALSGLSE DERADVELAH VLFAAAEKVG YHQFDRASRL LQRCEWTASS  240
YGNAVQRLVF YFAKALRKRI ERQTGRVSIE DSKEEEINFE ALKGCMKLPF QQVMHLTAVQ  300
AIFEHVKMTT KVHLIDLEIR SGVHWSAFMQ SLVDSKEIPI KLLKITAVVT DKIHLIEQVG  360
KWLENVADSL NIPFSFKPIL VSDMMEIKEE VFETEDDEMV AIYCPLVLRR MISRPGSLEN  420
LMRVIRNLNP SIMVVSEIEA NYNLPSFVNR FIEALFFTAS YFDCLKTCIG EDDESRRKME  480
AFCGVGIENA VASEGSDRVA RSVKIEVWRA FFGRFRMEEI ELSDSCFSQA KLVPKGFAFG  540
NFCSLEKNHK CLIVGWKETP IISISAWQFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3623756832375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004136152.10.0PREDICTED: DELLA protein RGL2
TrEMBLA0A0A0K9I90.0A0A0A0K9I9_CUCSA; Uncharacterized protein
STRINGPOPTR_0014s11510.11e-171(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-60RGA-like 2