PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 155aa    MW: 17549.7 Da    PI: 5.8484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014880genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM40.77.5e-1353796128
        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                +ge+vg++ktLvfy++rap+g kt W+mhe+r+
  Cla014880   5 RGEVVGMRKTLVFYRNRAPNGIKTGWIMHEFRI 37 
                5789***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.855156IPR003441NAC domain
SuperFamilySSF1019418.11E-19556IPR003441NAC domain
PfamPF023651.5E-5937IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDPTRGEVVG MRKTLVFYRN RAPNGIKTGW IMHEFRIETP HMPPKEDWVL CRVFHKTKPD  60
QDITETTTAH TASHFPFDAV MAAAAAAGSS SYHSLPNHVE FPPGNDSNGL LPWDINMEET  120
AFRSYGVGDS NSQEMKYEII DNTIQNAFPF NYFVP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818022e-52LN681802.1 Cucumis melo genomic scaffold, anchoredscaffold00046.
GenBankLN7132552e-52LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149326.12e-80PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A1S3C7P33e-71A0A1S3C7P3_CUCME; NAC domain-containing protein 21/22-like
STRINGXP_004164049.12e-81(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-29NAC domain containing protein 74