PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014685
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HB-other
Protein Properties Length: 972aa    MW: 107787 Da    PI: 9.393
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014685genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.14.6e-0669125157
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                +r+R  ++++ ++ ++++F  +  +s++e +e+++  g++ +qV+ +F  +R + +k
  Cla014685  69 KRPRDLLNPKAVKYMQTVFSIKDALSKKESREISALFGVKVTQVRGFFNSQRSRVRK 125
                799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.31366126IPR001356Homeobox domain
SuperFamilySSF466891.67E-568128IPR009057Homeodomain-like
SMARTSM003898.1E-468130IPR001356Homeobox domain
CDDcd000860.0040869125No hitNo description
Gene3DG3DSA:1.10.10.605.8E-569137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 972 aa     Download sequence    Send to blast
MEVLKDDFSN LEIGTSVDSF QKFLDSQKDL FRSQVDQLQT IVVTQCKLTG VNPLSQEMAA  60
GALSITIGKR PRDLLNPKAV KYMQTVFSIK DALSKKESRE ISALFGVKVT QVRGFFNSQR  120
SRVRKLVRVS REKSIQSNSC KQLEVGGIAT NNDPSMPIDA VPLNSDAVVP LNADAPIPLN  180
SESPVPLNFD MPVPLNTIEP SNVDNGPSCS TQDRELCGID GVDKHFVQTI FSMMQKEETF  240
SGQVKLMEWI LQIQNSSVLC WFLTKGGAII LATWLSQAAA EEQTSLLHVI LEENFVTSNV  300
NVDNMRKPES HQTLKLLPAS SDDLNRKNVL GFRERRKVQM VEQPDQKIAG RNSQAPRTSP  360
ASQGRPMSTD DIQKAKMRAQ FMQSKYGKTG SSNGRSNVKS ENVNKPLHLV SGVSSPASKV  420
SVLPKFEDQK KAVALFPKFS NKVETPLHSK IEMDFKDSLG EKCKRVQIQW RKPPEMKLND  480
LWRVGGGENS KEAGFQKNRN SREKETFYQT ILDIPSNPKE PWDLEMDYDD SLTPEILTEQ  540
LPDNESSEAE VRNHVVDAAV SSEVLSSQDL KPNAAEPDLE LLAVLLKNPE LVYALTSSQA  600
GNLPTEETVK LLDMIKTGGA SNLGGVRMEK TVEKVEVSLP SPTPSSNAGT SGWKPAVLRN  660
PFSQRDSIAE SRVALSSPPV DTSSIAASRI PANNVTSNHQ HAAMPPVSHQ HPASVSQFSH  720
PQTMINGRQS HHVVHSHQHQ QGVVNSPSTL NVQLPNSETA LASRSFPITN QPLVNRLTAA  780
ASSVRIEGRN IVKPVSFASN TPERIPISFQ SPPSPTPTQM PPIQQQRQQV QLQPFRSEHP  840
HHQTRVNISL PPAEKSAPSL GCWRGRQQDI GSHYNSGANQ NNDSKLVGGS MAAVRGGHSW  900
GRNEFESWSP ENSPVRTQEY NRPDKSFTEP RINSGRSYGP ADQQQQRQRS PYGYREQNRH  960
GNSNRRWRDR QY
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011659347.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
RefseqXP_023548067.10.0homeobox protein LUMINIDEPENDENS-like
SwissprotQ387964e-89LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0A0K9480.0A0A0A0K948_CUCSA; Uncharacterized protein
STRINGXP_004136181.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.25e-83HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]