PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GATA
Protein Properties Length: 291aa    MW: 31978.5 Da    PI: 9.0045
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014546genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18212246135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Cla014546 212 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 246
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.95E-14205268No hitNo description
SMARTSM004012.4E-16206260IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.807206242IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-14210244IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.09E-14211259No hitNo description
PfamPF003201.6E-16212246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MLSPPMMFSS TNSSICLIMM NFFKTKPLMM IHNPYLSLSI SISPPQIHHN SIVSDLPSFS  60
STELTVPADD LADLEWLSHF VEDSFSGFSP TFPSPGISSL KKSSKEAAAV EEQLEDDGPV  120
SPPDPCFKTP IPVKARSKRT RTTGRVWCLG SPSLTESSSC STTSSSSSSP ASPWLIISDR  180
FEPEIPVSKK PRRKSPSEKS KTTIGAQPPR RCSHCGVQKT PQWRTGPLGA KTLCNACGVR  240
FKSGRLLPEY RPACSPTFSS ELHSNHHRKV LEMRRKKEVA APAEFLTVEE N
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465634.11e-139PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH576e-68GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A0A0KUP51e-134A0A0A0KUP5_CUCSA; Uncharacterized protein
STRINGVIT_04s0023g02880.t012e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-60GATA transcription factor 5