PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla014262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GATA
Protein Properties Length: 296aa    MW: 33484.1 Da    PI: 7.3882
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla014262genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.15.8e-19218251134
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                Cs+Cg+ kTp+WR gp g k+LCnaCG+++++ +
  Cla014262 218 CSHCGVQKTPQWRAGPLGAKSLCNACGVRFKSGR 251
                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.8E-7511293IPR016679Transcription factor, GATA, plant
SuperFamilySSF577165.7E-14211274No hitNo description
SMARTSM004012.8E-15212266IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.53212248IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.8E-14216249IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.18E-13217265No hitNo description
PROSITE patternPS003440218243IPR000679Zinc finger, GATA-type
PfamPF003206.2E-17218251IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEAALKMGVT KEMTFKSSPK LHFDEFWSSN PQNAASPSSD YIFVDQLLNF SNEEEEEEEE  60
AEGEEKNNHS SVSAPLQLKQ HHDSDQISNH SSTNSSEDDF WSISSRDFED LEWLSHLVAD  120
STQEEYSAAP PPCSVFLTQK PINYQKETTH HRKAQNFEFN LNTPFPSKPR SKRAKISGRV  180
WSLTNSIPSP SLYSPPAKKP KKNPAEESSS RVQAPRRCSH CGVQKTPQWR AGPLGAKSLC  240
NACGVRFKSG RLFPEYRPAC SPTFSSELHS NHHRKVLEMR RKKETEKPHS GLEPAL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440788.11e-141PREDICTED: GATA transcription factor 7-like
TrEMBLA0A0A0KJA51e-131A0A0A0KJA5_CUCSA; Uncharacterized protein
STRINGVIT_04s0023g02880.t014e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-52GATA transcription factor 5