PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013731
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 563aa    MW: 63039.6 Da    PI: 4.3235
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013731genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.7e-5191361128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdee+v +yL++kv+gk+l++ + i+ ++iyk+ePwdLp k k+k+++ ewyfFs+ dkky +++r+nrat++gyWk+tgkd++v + +++
  Cla013731   9 LAPGFRFHPTDEEIVRYYLRRKVSGKSLRF-DPISVTEIYKSEPWDLPgKsKLKTRDLEWYFFSPLDKKYGNSSRTNRATENGYWKTTGKDRPVRH-NSR 106
                579*************************99.89***************5347777888**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kktLv+++grap+g++++Wvmheyrl
  Cla013731 107 VVGMKKTLVYHSGRAPRGTRSNWVMHEYRL 136
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-627159IPR003441NAC domain
PROSITE profilePS5100557.559159IPR003441NAC domain
PfamPF023654.7E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MGSDSATSLA PGFRFHPTDE EIVRYYLRRK VSGKSLRFDP ISVTEIYKSE PWDLPGKSKL  60
KTRDLEWYFF SPLDKKYGNS SRTNRATENG YWKTTGKDRP VRHNSRVVGM KKTLVYHSGR  120
APRGTRSNWV MHEYRLTDED LEKAGVVQDA YVLCRIFQKS GSGPKNGEQY GAPFIEEEWE  180
DDKELTLPGE EVVANEGLVD VDDDMHFELD DIAQQFFDGE LPSEYAQPLS NYPQDTSNHV  240
ELPNVENDNK PEVFAGNTFE LPQSHDFFHL PDQYGMGGNS EKDECFAESS GNFAESSDNF  300
KQEDIDYLLE EPYPSVPDDL ALNEELFLEA NDLSNPVDSD PTGLDVLEEY LTFFDADDDN  360
LQLAFDPSDV LGIEEPTSGR AILEEKVNGV AEEEFMATKQ SSMASTNDAS TSNKNPEAIE  420
TGSDSKSSFL KRASYLLGNI PAPPAFASEY PSKDMAIRLN SAAQTSSSVH VTAGMIHIRN  480
LTSSGDLANS LYGKNADVNL ILSFARHQHQ RESDDMIPQL PLFGAQSEKN GIMGSRGFLF  540
FFLLFWVLLL SVSFKVGSCI YSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-4831659174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818211e-131LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132571e-131LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649428.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
TrEMBLA0A1S4E1940.0A0A1S4E194_CUCME; NAC domain-containing protein 78-like isoform X1
STRINGXP_008456548.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-134NAC domain containing protein 2