PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013474
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 319aa    MW: 36805.4 Da    PI: 8.0531
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013474genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.91.7e-48201483128
        NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kge 98 
                pGfrFhPtdeelv++yL++kve+k+++l e ik++diy+++PwdLp +  +++eke+y F+kr +ky+++ r+nr+t +g+Wkatg dk+++s+   +++
  Cla013474  20 PGFRFHPTDEELVDYYLRRKVEKKSITL-ELIKQIDIYQHNPWDLPySGGATGEKECYVFVKRGRKYKNSVRPNRVTGAGFWKATGIDKPIYSQegeGNH 118
                9*************************99.99***************556667899**************************************9766666 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +glkktLvfykg+a +g+kt+W+mhe+rl
  Cla013474 119 CIGLKKTLVFYKGSAGRGVKTEWMMHEFRL 148
                6***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100550.2418176IPR003441NAC domain
SuperFamilySSF1019413.14E-5018176IPR003441NAC domain
PfamPF023654.3E-2420148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005992Biological Processtrehalose biosynthetic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006561Biological Processproline biosynthetic process
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010120Biological Processcamalexin biosynthetic process
GO:0042538Biological Processhyperosmotic salinity response
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MATTTTPPDF DNDDYQFPLP GFRFHPTDEE LVDYYLRRKV EKKSITLELI KQIDIYQHNP  60
WDLPYSGGAT GEKECYVFVK RGRKYKNSVR PNRVTGAGFW KATGIDKPIY SQEGEGNHCI  120
GLKKTLVFYK GSAGRGVKTE WMMHEFRLPP ITCSTSHFAK TDQEAEIWTL CRIFKRNVMC  180
RRYTANNWKE IPGVNREMTK ITKKCSNIMD HDQSSHDGVD QRATYISFSS NSYSGFEIEK  240
KPLLVCDKRK QWEEFTMKKK RKNSEAAEVI SLSANQSPAS SGFSNFDENG TDLFGSSDDH  300
WEELRSIVDF AFDPFLNNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-442017617168Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1247261KRKQWEEFTMKKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00310DAPTransfer from AT2G43000Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819211e-126LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132651e-126LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150047.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0A0KEH50.0A0A0A0KEH5_CUCSA; Uncharacterized protein
STRINGXP_004150047.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.13e-81NAC domain containing protein 42