PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 173aa    MW: 19013.6 Da    PI: 7.7712
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013469genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.29e-46151141100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la +++e
  Cla013469  15 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELPEQQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDLLQTQLAIAQAE 114
                7**********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3914115IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4515112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKEIGGRKQG TSLSPCAACK LLRRRCAQDC VFAPYFPADE PHKFASVHKV FGASNVNKML  60
QELPEQQRSD AVSSMVYEAN ARVRDPVYGC VGAISSLQQQ IDLLQTQLAI AQAEVVHMRM  120
RQFPSTSCNP TAGHSPETTS PSGKMNIPAP NKSYFSMDMV DHDNMGESLW SSC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6837061e-106LN683706.1 Cucumis melo genomic scaffold, unassembled_sequence31212.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150042.11e-123PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE94e-70LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0A0KBA81e-123A0A0A0KBA8_CUCSA; Uncharacterized protein
STRINGSolyc11g045530.1.15e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.16e-62LOB domain-containing protein 4