PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 161aa    MW: 17928.2 Da    PI: 4.8891
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013390genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-4271061100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+CakdC++apyfp+++p kfa+vhk+FGasnv+k+l+++p e+r da+ss+vyeA ar+rdPvyG+vg+i+ lq+++++l+ +l ++++e
  Cla013390   7 PCASCKLLRRRCAKDCIFAPYFPSDDPFKFAIVHKIFGASNVSKMLQEVPIEQRADAVSSMVYEASARMRDPVYGCVGTISFLQNEVSRLEMQLGAAQAE 106
                7********************************************************************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.26107IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-417104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MGAGSSPCAS CKLLRRRCAK DCIFAPYFPS DDPFKFAIVH KIFGASNVSK MLQEVPIEQR  60
ADAVSSMVYE ASARMRDPVY GCVGTISFLQ NEVSRLEMQL GAAQAEILTL HMQQQATPTT  120
FPTTTTHTDQ DDQNLVIFSN ADSSNSFHIF QEEGDYYPLW T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143222.19e-96PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW31e-67LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0A0KBK51e-95A0A0A0KBK5_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000782564e-72(Solanum tuberosum)
STRINGSolyc06g082310.2.14e-72(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-66LBD family protein