PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla012305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 445aa    MW: 49329 Da    PI: 7.1637
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla012305genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.6e-32236291156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Cla012305 236 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 291
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-17233294IPR009057Homeodomain-like
PROSITE profilePS5129413.355233293IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-28234294IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26236291IPR006447Myb domain, plants
PfamPF002497.7E-7238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MLLKHSFGDH EEQLGGNNNY DEYSYDKLQE FVTRLEEERL KIDVFKRELP LCMQLLTNAV  60
ETSRRQLEAW KTVEAVPAKP VLEEFMPLKI STPAEEEKPP TIMSDKANWM TSVQLWSRAA  120
DVSKHKSTPN NNESTNCNDS NNNNSETCND QRINNNGAFV PFNKDRSSGP GLGLGGGEKM  180
ELLEKAEKKN NINCSDNIKS GNNDNNGGVG MAVDQSSENG AAEVGSAPTT TQTHRKARRC  240
WSPDLHRRFV NALQMLGGSQ VATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRPGPTQQ  300
ASGPPAAQLV VLGLGGLWVP PEYAAAAAAA PPALYGPPPT SHPPSHFYTP PSLPQEFYTR  360
TGPAPHLQHH HQVQLYKGAP QSSPESEVRD TAERSESFEE EKSGSSSWRI EGCENGDDRI  420
INGRGSCGRR SDRKRMKKVI EVKLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-14236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-14236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-14236289154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-14236289154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818103e-81LN681810.1 Cucumis melo genomic scaffold, anchoredscaffold00077.
GenBankLN7132563e-81LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463337.10.0PREDICTED: transcription activator GLK1-like
TrEMBLA0A1S3CJ160.0A0A1S3CJ16_CUCME; transcription activator GLK1-like
STRINGXP_008463337.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-76G2-like family protein