PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla012151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 859aa    MW: 92874.5 Da    PI: 6.601
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla012151genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.14.6e-1294778362374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lLl+cAeavs+++le+a+++L ++sel++p g++ qR+aayf eA++arl++s+ ++y+alpps  ++++s++ ++a+++f+ +sP++kfsh+taNqa
  Cla012151 477 LTLLLQCAEAVSADNLEEANKMLLEISELSTPFGTSAQRVAAYFSEAMSARLVSSCLGIYAALPPSLVPHTHSQKIASAFQVFNGISPFVKFSHFTANQA 576
                579************************************************************************************************* PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                I ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s+e le+tg+rL++fAe+lg+pf+f + va+++ +l+le+L+v+++Ea
  Cla012151 577 IQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SQEVLEATGKRLTEFAEKLGLPFDFFP-VADKIGNLDLERLNVSKREA 671
                ************************************************....9**************************.7******************* PP

       GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                +aV+++   h+l++ ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl +++++eseer+ vE++ll+rei+nv+a  
  Cla012151 672 VAVHWMQ--HSLYEVTGSDSN----TLWLLQRLAPKVVTVVEQDLSH-TGSFLGRFVEAIHYYSALFDSLGVSYGEESEERHLVEQQLLSREIRNVLAVG 764
                ******9..999988888888....**********************.889************************************************* PP

       GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                g +r  + + +++Wre+l+++GFk ++l  +aa+qa lll +++sdgy++ e++g+l lgWkd  L+++SaW+
  Cla012151 765 GPSRSGEVK-FQNWREKLQQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASAWK 836
                ***888776.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.797450816IPR005202Transcription factor GRAS
PfamPF035141.6E-126477836IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MAAYALLGDS TPRVNGGFDD SPLTSASTNS NGSDEHNHQQ IVQVQVQVAQ PRLPVGKMVR  60
KRIASEMEIE GGGGGGGGVT AAVHPRFCRR SLASDRPFAG GENKANANAN YCSSNPSHGG  120
GNHSTVHNLT ALTSVVIEGS NLSNPPSGSD ATVSSTTSNN NLLDSTLPVL RPQPHHHHLQ  180
NPAVCGFSGL PLFPPELNHH HKLNTRNNPF PLPNPSQVLH NPPTTATTSI IAAASSPMDD  240
SSATAWIDGI IKDLIHSSTA ISIPQLIQNV REIIYPCNPN LANLLEFRLR TLTDPSVPNF  300
AAEDHRVRKS PLPLPPPVAG LGLQQRQFNQ EQHEQEQDCS GLKLNLDSSS LHNLPNFPSQ  360
PPFHEPYLQW GTTPPPVPTP SAAAAGEDAL QRLPGHHQLN LSSVTPSPLV SLNHVPSKPQ  420
SEQQNSCPVN AKAAVAQPAP APPPSTSNNP SATALLIREI KEEMRQQKRD EEGLHLLTLL  480
LQCAEAVSAD NLEEANKMLL EISELSTPFG TSAQRVAAYF SEAMSARLVS SCLGIYAALP  540
PSLVPHTHSQ KIASAFQVFN GISPFVKFSH FTANQAIQEA FEREERVHII DLDIMQGLQW  600
PGLFHILASR PGGPPYVRLT GLGTSQEVLE ATGKRLTEFA EKLGLPFDFF PVADKIGNLD  660
LERLNVSKRE AVAVHWMQHS LYEVTGSDSN TLWLLQRLAP KVVTVVEQDL SHTGSFLGRF  720
VEAIHYYSAL FDSLGVSYGE ESEERHLVEQ QLLSREIRNV LAVGGPSRSG EVKFQNWREK  780
LQQSGFKGIS LAGNAATQAT LLLGMFPSDG YTLVEDNGTL KLGWKDLCLL TASAWKPPFL  840
HHAAAAAAPA ATNNHIPRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-494768364375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ8703060.0AJ870306.1 Cucumis sativus mRNA for SCARECROW (scr gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295787.10.0protein SCARECROW 1
SwissprotQ2Z2E90.0SCR_IPONI; Protein SCARECROW
TrEMBLA0A0A0KWH90.0A0A0A0KWH9_CUCSA; Uncharacterized protein
STRINGVIT_08s0056g00050.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20683489
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein