PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla012144
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 323aa    MW: 36583.3 Da    PI: 6.5217
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla012144genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.2e-56111381129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdee+v++yL +k+++ ++++ ++i e+d++k+ePwdLp+k+k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkd+e+++ k+ l 
  Cla012144  11 LPPGFRFHPTDEEIVTYYLSQKIANPTFTA-TAIGEADLNKCEPWDLPQKAKMGEKEWYFFCQRDRKYPTGMRTNRATQTGYWKATGKDREIFKGKSVLA 109
                79*************************999.88***************99999*****************************************99999* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrle 129
                g+kktLvfykgrap+gekt+Wvmhe+rle
  Cla012144 110 GMKKTLVFYKGRAPRGEKTNWVMHEFRLE 138
                **************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-618164IPR003441NAC domain
PROSITE profilePS5100557.76611163IPR003441NAC domain
PfamPF023657.2E-2912137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MEEPPSTAVN LPPGFRFHPT DEEIVTYYLS QKIANPTFTA TAIGEADLNK CEPWDLPQKA  60
KMGEKEWYFF CQRDRKYPTG MRTNRATQTG YWKATGKDRE IFKGKSVLAG MKKTLVFYKG  120
RAPRGEKTNW VMHEFRLEPK YSHFLRHARP VKDDWVVFRV FHKNPTTSST TLVGRIQTSD  180
FSSSLPPLMD PSASCIPINA GFDDFEAKYR PPKPSDYNYL KYMSIGTNDH QPEATLPSLA  240
TSAAMTMNVP FPSSVPDDEF FSFDQLAAGG TTSITPLPTT MERKMEQVSW STMSGVTQDM  300
SPSIENSGYV AADMADLDLW DYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-5321678169NO APICAL MERISTEM PROTEIN
1ut4_B9e-5321678169NO APICAL MERISTEM PROTEIN
1ut7_A9e-5321678169NO APICAL MERISTEM PROTEIN
1ut7_B9e-5321678169NO APICAL MERISTEM PROTEIN
3swm_A1e-52216811173NAC domain-containing protein 19
3swm_B1e-52216811173NAC domain-containing protein 19
3swm_C1e-52216811173NAC domain-containing protein 19
3swm_D1e-52216811173NAC domain-containing protein 19
3swp_A1e-52216811173NAC domain-containing protein 19
3swp_B1e-52216811173NAC domain-containing protein 19
3swp_C1e-52216811173NAC domain-containing protein 19
3swp_D1e-52216811173NAC domain-containing protein 19
4dul_A9e-5321678169NAC domain-containing protein 19
4dul_B9e-5321678169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441966.11e-162PREDICTED: NAC domain-containing protein 79-like
SwissprotQ9FK444e-95NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A1S3B4421e-160A0A1S3B442_CUCME; NAC domain-containing protein 79-like
STRINGXP_008441966.11e-161(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.21e-97Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]