PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla011761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 302aa    MW: 33920.2 Da    PI: 7.5677
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla011761genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42.1e-5191341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l + i+e+d+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + s +g++v
  Cla011761   9 LPPGFRFFPTDEELLVQYLCRKVAGHHFNL-QLIAEIDLYKFDPWVLPGKALFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIISS-EGKNV 106
                79***************************9.89***************8777899*********************************999998.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  Cla011761 107 GIKKALVFYVGKAPKGTKTNWIMHEYRL 134
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-664158IPR003441NAC domain
PROSITE profilePS5100560.0179157IPR003441NAC domain
PfamPF023659.2E-2610134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDPLMQLSLP PGFRFFPTDE ELLVQYLCRK VAGHHFNLQL IAEIDLYKFD PWVLPGKALF  60
GEKEWYFFSP RDRKYPNGSR PNRVAGSGYW KATGTDKIIS SEGKNVGIKK ALVFYVGKAP  120
KGTKTNWIMH EYRLISSSRK TGSSKLDDWV LCRIYKKNSS CQKPTGSISS KEYSNGSPLS  180
SSSSHIDEVI ESLPEMGDDF FAYPKTTLQQ NDIMNKFHFE IPADSVNSDW ASLAGLYSVP  240
ELAPVDHSGT FDYNNNNNNN TIADLYVPSI TSPFCQVDYP PPPAFRYSTQ QHGGGGMFGF  300
SQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-106216310171NO APICAL MERISTEM PROTEIN
1ut4_B1e-106216310171NO APICAL MERISTEM PROTEIN
1ut7_A1e-106216310171NO APICAL MERISTEM PROTEIN
1ut7_B1e-106216310171NO APICAL MERISTEM PROTEIN
3swm_A1e-106216313174NAC domain-containing protein 19
3swm_B1e-106216313174NAC domain-containing protein 19
3swm_C1e-106216313174NAC domain-containing protein 19
3swm_D1e-106216313174NAC domain-containing protein 19
3swp_A1e-106216313174NAC domain-containing protein 19
3swp_B1e-106216313174NAC domain-containing protein 19
3swp_C1e-106216313174NAC domain-containing protein 19
3swp_D1e-106216313174NAC domain-containing protein 19
4dul_A1e-106216310171NAC domain-containing protein 19
4dul_B1e-106216310171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818581e-123LN681858.1 Cucumis melo genomic scaffold, anchoredscaffold00028.
GenBankLN7132601e-123LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004133700.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9SQL01e-118JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A0A0L6K60.0A0A0A0L6K6_CUCSA; Uncharacterized protein
STRINGXP_004171487.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44293360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-115NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]