PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla011760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 340aa    MW: 38077.6 Da    PI: 9.2596
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla011760genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81.1e-53151431128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                lppGfrFhPtdeelvv+yLkkk+++++l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra++sgyWkatg+dk+vl++  +++
  Cla011760  15 LPPGFRFHPTDEELVVHYLKKKANSSPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRERKYPNGARPNRAATSGYWKATGTDKPVLASggSNQ 113
                79****************************.88***************988899****************************************987778 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg+kk Lvfy g+ pkg kt+W+mheyrl
  Cla011760 114 KVGVKKALVFYGGKPPKGIKTNWIMHEYRL 143
                8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-6410178IPR003441NAC domain
PROSITE profilePS5100561.63715178IPR003441NAC domain
PfamPF023654.2E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MESTDSSGGP QQPNLPPGFR FHPTDEELVV HYLKKKANSS PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRERK YPNGARPNRA ATSGYWKATG TDKPVLASGG SNQKVGVKKA  120
LVFYGGKPPK GIKTNWIMHE YRLADNKPSI NKPPGYDLAN KKNSLKLDDW VLCRIYKKNN  180
SHRPMDHQKR EDSMEDMIGS IPQSLRLNEY PKLGINYTTL LENDQSLLQG MVANNNNDAT  240
NPKRPASLFW TEEEDHSGIS SSKRLHFETT TDGASTSITR THSNDNNLQN STSSFTTLLT  300
NLPQTPPPPL HHHASHSVLA SMGDGLFRPA YQIPGANWYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-731218114168NO APICAL MERISTEM PROTEIN
1ut4_B3e-731218114168NO APICAL MERISTEM PROTEIN
1ut7_A3e-731218114168NO APICAL MERISTEM PROTEIN
1ut7_B3e-731218114168NO APICAL MERISTEM PROTEIN
3swm_A3e-731218117171NAC domain-containing protein 19
3swm_B3e-731218117171NAC domain-containing protein 19
3swm_C3e-731218117171NAC domain-containing protein 19
3swm_D3e-731218117171NAC domain-containing protein 19
3swp_A3e-731218117171NAC domain-containing protein 19
3swp_B3e-731218117171NAC domain-containing protein 19
3swp_C3e-731218117171NAC domain-containing protein 19
3swp_D3e-731218117171NAC domain-containing protein 19
4dul_A3e-731218114168NAC domain-containing protein 19
4dul_B3e-731218114168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818581e-113LN681858.1 Cucumis melo genomic scaffold, anchoredscaffold00028.
GenBankLN7132601e-113LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149287.10.0PREDICTED: NAC transcription factor 25
SwissprotQ9LD441e-109NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0A0L2L30.0A0A0A0L2L3_CUCSA; Uncharacterized protein
STRINGXP_004149287.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-108NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]