PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla011554
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 329aa    MW: 37854.7 Da    PI: 6.8776
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla011554genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.6e-5671371129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                +ppGfrFhPtdeelv++yL+kkv +k+++l ++ik+vd+y++ePwdL++    + +++++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++++ +
  Cla011554   7 VPPGFRFHPTDEELVDYYLRKKVGSKRIDL-DIIKDVDLYRIEPWDLQElcklAGSEDQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYA-R 104
                69****************************.99**************9545433333667**************************************.8 PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                ++lvg++ktLvfykgrap+g+k+dW+mheyrle
  Cla011554 105 HSLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 137
                89*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-605157IPR003441NAC domain
PROSITE profilePS5100559.8017157IPR003441NAC domain
PfamPF023651.1E-288136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MNCIPHVPPG FRFHPTDEEL VDYYLRKKVG SKRIDLDIIK DVDLYRIEPW DLQELCKLAG  60
SEDQNEWYFF SHKDKKYPTG TRTNRATKAG FWKATGRDKA IYARHSLVGM RKTLVFYKGR  120
APNGQKSDWI MHEYRLETNE NATPQEEGWV VCRVFKKRMP TVRKSGDYGS PCWYDDQVSF  180
MPELDSPTTQ IFHHPAYPCK QELELHFHAP PHDQVFLQLP HLESPKIPTS STTNSLLPYA  240
YDRDTSVAPL YGVEHAADHV TDWRVMEKFV ASQLSNDQDL KQSNYSHGAI FQVPPSSGGA  300
ATMSECERKD MAPEFALASP SSCQVDMWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-48615814169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147614.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-138NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0A0KKJ40.0A0A0A0KKJ4_CUCSA; Uncharacterized protein
STRINGXP_004147614.10.0(Cucumis sativus)
STRINGXP_004167328.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-140NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]