PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla011315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 487aa    MW: 55281.7 Da    PI: 6.6122
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla011315genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.91e-49121411128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                lp+GfrFhPtd+el+++yLk k+ g++  + + i++vdi+++ePw+Lpk  + ++++++w+fFs +d ky++g+r+nrat++gyWk+tgkd+++++  ++
  Cla011315  12 LPVGFRFHPTDDELINHYLKYKIVGQESLV-QYIPQVDICNYEPWELPKqsNDQTGDRQWFFFSAQDFKYSNGRRSNRATRTGYWKSTGKDRKIMAPgTR 110
                79*************************777.88***************5234445888**************************************9666 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                +l+g+kktLvfy+gr p+g++t+Wv+hey+l
  Cla011315 111 TLIGTKKTLVFYSGRVPNGNRTNWVIHEYHL 141
                77****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-536161IPR003441NAC domain
PROSITE profilePS5100554.02112161IPR003441NAC domain
PfamPF023652.9E-2613141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MANSLLLPPQ ELPVGFRFHP TDDELINHYL KYKIVGQESL VQYIPQVDIC NYEPWELPKQ  60
SNDQTGDRQW FFFSAQDFKY SNGRRSNRAT RTGYWKSTGK DRKIMAPGTR TLIGTKKTLV  120
FYSGRVPNGN RTNWVIHEYH LHPDPNFAHL RSFVICRLKR KWNESDVLKC EEAEPNGLLT  180
STNVAIVNQN QENPGNGQSL FQSDLQVSDY DVSELLSPFF PDPEPISMDF QVINSYGTHV  240
KGPTYEDVNS VLVDDENCFH EGTSNSSISD FNFNWEELFD LVNDQDQGDG FSGDTGMDTG  300
LSWQYDHASS SFFGESSCSM IQTQSMPMIN ESRRSPLTSK ILKYGEAKDR LEANCLLYHS  360
DRETRNLSSQ HQPKTRKVLN HVDASRNLQS KRETQLQVVS SHSKAKAIPK RIEVVRLAPK  420
SNKDSVEDQQ GEVENGITYL LKSTGHGSLE SILTTKCIHH KSSPASYFAR ACVGFILLIT  480
FARQALL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-421216415171Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450706.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A1S3BQH10.0A0A1S3BQH1_CUCME; protein CUP-SHAPED COTYLEDON 3-like
STRINGXP_008450706.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-52NAC transcription factor-like 9