PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 293aa    MW: 33172.2 Da    PI: 5.3282
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010351genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.22.1e-41101091100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                aCaaCk++rr+C+kdC+lapyfpa+qpk f+n+h+lFG+ n++k+lk++++++++++m+s++ye+++r r Pv+G++gvi++l+ q++q+++el +++++
  Cla010351  10 ACAACKYQRRRCSKDCALAPYFPADQPKMFQNAHRLFGVCNIMKILKQVHPSQKDETMTSIIYESNMRSRFPVHGCCGVIWQLHYQIQQVAEELRQVRTR 109
                7*********************************************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5959110IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-3910107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRRR CSKDCALAPY FPADQPKMFQ NAHRLFGVCN IMKILKQVHP  60
SQKDETMTSI IYESNMRSRF PVHGCCGVIW QLHYQIQQVA EELRQVRTRI DMVKEQYNQM  120
NNVGIAEGIV GSNDVYPIYT HQQHQQQYNS GLLVNQATDG SDLLFGNLNS GGIYVDIDDN  180
SGLMLKELRI QQHYNDNYGI NISNVDSMMM QSNLIPAVQG YPLQQEMEIS HDYDEIPFDT  240
IADDRQSYIE SKEACDSSAE STFKDVSETS AEYVSRTDLK NAAACFSLTS HVK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132631e-122LN713263.1 Cucumis melo genomic chromosome, chr_9.
GenBankLN6818891e-122LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230975.11e-104PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A0A0KXA10.0A0A0A0KXA1_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-46LOB domain-containing protein 27