PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 304aa    MW: 33618.7 Da    PI: 6.954
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010341genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.5e-1882134456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Cla010341  82 KKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 134
                4568889*********************************************9 PP

2HD-ZIP_I/II127.17.6e-4180170191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dye+Lk++++alk++n+ L++++++L++el
    Cla010341  80 EKKKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYEVLKKQFEALKADNDVLQAQNTKLHAEL 170
                  69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-1960137IPR009057Homeodomain-like
SuperFamilySSF466895.56E-1979138IPR009057Homeodomain-like
SMARTSM003893.3E-1779140IPR001356Homeobox domain
PROSITE profilePS5007116.53680136IPR001356Homeobox domain
CDDcd000869.13E-1781137No hitNo description
PfamPF000463.1E-1582134IPR001356Homeobox domain
PRINTSPR000311.1E-5107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5116132IPR000047Helix-turn-helix motif
PfamPF021832.7E-14136176IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MASPHHSHSF MFQSRPADHH EYVPSASFNA IPSCPPHLYF HDGVVPVMMK RSMSFSGVEN  60
GCEEVNGDEG LSDDGLALGE KKKRLNLEQV KALEKSFELG NKLEPERKMQ LAKALGLQPR  120
QIAIWFQNRR ARWKTKQLER DYEVLKKQFE ALKADNDVLQ AQNTKLHAEL LALKTKDSGE  180
AAGGGATMNL KKENERCWSS DNSCDINLDI SKTQAPINGS GGGGGGRACS QPGIIKDLFP  240
SAAFRSAAIT QLLQHGSSRS TVDHPQVIQE ESFSQMFNGI EEQQQTAAAA GFWPWSSDQN  300
SHFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818891e-147LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132631e-147LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459304.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ004663e-82HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A1S3C9V40.0A0A1S3C9V4_CUCME; homeobox-leucine zipper protein ATHB-20-like
STRINGXP_008459304.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.19e-85homeobox 3