PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla009148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 118aa    MW: 13007.7 Da    PI: 10.8735
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla009148genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-3252106256
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ++R +
  Cla009148  52 PRMRWTSSLHSQFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMFRAH 106
                9****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-1649106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-2850106IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-2452107IPR006447Myb domain, plants
PfamPF002496.1E-753103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MSTSPTFFSS SSSSSISYSK ISTFTSPPPY LHYQLDSGRS STVARGRSMR APRMRWTSSL  60
HSQFVHAVEL LGGHERATPK SVLELMDVKD LTLAHVKSHL QMFRAHKTTD KPAASPGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-1853104354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-1853104354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-1853104354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-1853104354Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-1853104455Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818943e-50LN681894.1 Cucumis melo genomic scaffold, anchoredscaffold00074.
GenBankLN7132633e-50LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463176.12e-58PREDICTED: probable transcription factor KAN2
SwissprotQ93WJ92e-37KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A1S3CJ014e-57A0A1S3CJ01_CUCME; probable transcription factor KAN2
STRINGXP_008463176.17e-58(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-39G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Huang T,Kerstetter RA,Irish VF
    APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis.
    J. Exp. Bot., 2014. 65(4): p. 1181-91
    [PMID:24449383]
  3. Mach J
    Getting in Shape? Leaves work it out with KANADI1.
    Plant Cell, 2014. 26(1): p. 4
    [PMID:24464293]
  4. Jun SE, et al.
    Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.
    Mol. Cells, 2015. 38(3): p. 243-50
    [PMID:25518926]
  5. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  6. Xie Y, et al.
    Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways.
    Plant Physiol., 2015. 169(2): p. 1240-53
    [PMID:26246448]
  7. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  8. Singh A, et al.
    Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana.
    Sci Rep, 2017. 7(1): p. 3408
    [PMID:28611467]
  9. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]
  10. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]