PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 203aa    MW: 23631.5 Da    PI: 9.8977
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008633genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.81.6e-43161472127
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratk..sgyWkatgkdkevlsk 95 
                 pGfrF Pt+eelv++yL++++eg++ ++++vi+ vdiy +eP +L +    +++ ++++w+fF+k+++++a+g r+nr+t+  sgyWkatg+   v+s+
  Cla008633  16 LPGFRFFPTEEELVSFYLHNQLEGRRKDIHRVIPVVDIYAIEPFNLSRysgeRCRRDNEQWFFFVKQQEREARGGRANRTTSsgSGYWKATGSPAYVYSS 115
                69***************************99***************8445666666888********************8876689************** PP

        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyr 127
                +++++g+kkt+vfy+g+ap+g+kt+W m+ey+
  Cla008633 116 HNKVIGVKKTMVFYRGKAPTGNKTKWKMNEYK 147
                *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-4414180IPR003441NAC domain
PROSITE profilePS5100544.65915181IPR003441NAC domain
PfamPF023652.2E-2217147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEEYQVIGND IEDEILPGFR FFPTEEELVS FYLHNQLEGR RKDIHRVIPV VDIYAIEPFN  60
LSRYSGERCR RDNEQWFFFV KQQEREARGG RANRTTSSGS GYWKATGSPA YVYSSHNKVI  120
GVKKTMVFYR GKAPTGNKTK WKMNEYKAIQ DHIPPHSHSP SSSTPTPQLR HEFSLCRVYV  180
VSGSFRAFDR RPLQAHNSST HIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-271717922166NAC domain-containing protein 19
3swm_B2e-271717922166NAC domain-containing protein 19
3swm_C2e-271717922166NAC domain-containing protein 19
3swm_D2e-271717922166NAC domain-containing protein 19
3swp_A2e-271717922166NAC domain-containing protein 19
3swp_B2e-271717922166NAC domain-containing protein 19
3swp_C2e-271717922166NAC domain-containing protein 19
3swp_D2e-271717922166NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818427e-80LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132597e-80LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449583.11e-122PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR39e-81NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A1S3BMD51e-121A0A1S3BMD5_CUCME; NAC domain-containing protein 90
STRINGXP_008449583.11e-122(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-81NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]