PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 480aa    MW: 53715.7 Da    PI: 4.5946
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008434genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.81.8e-4861331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPt  elv++yLkkkv +kkl++  vi+e+diyk+ PwdLp k ++k+++ +wyfF++r++kya+g r nrat+ gyWk+tgkd++v   ++e
  Cla008434   6 LPPGFRFHPTHVELVMFYLKKKVMQKKLPA-GVISELDIYKYAPWDLPeKsCLKSGDLKWYFFCPRERKYASGARMNRATQFGYWKSTGKDRPVNY-NNE 103
                79****************************.99**************96357888999*************************************9.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vg  ktL+f++g+apkg +tdWvmheyr+
  Cla008434 104 EVGQIKTLTFFRGKAPKGDQTDWVMHEYRI 133
                9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-554156IPR003441NAC domain
PROSITE profilePS5100553.5356156IPR003441NAC domain
PfamPF023658.1E-247133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MRKRSLPPGF RFHPTHVELV MFYLKKKVMQ KKLPAGVISE LDIYKYAPWD LPEKSCLKSG  60
DLKWYFFCPR ERKYASGARM NRATQFGYWK STGKDRPVNY NNEEVGQIKT LTFFRGKAPK  120
GDQTDWVMHE YRIEEKNLSL EDAAQNGYVL CVIFQKDGPG PRNGAQYGAP FREEDWEEDG  180
LEEVDSLEVD LSSGLSVLPS KEPLNSFAPD TSLTPSNNFG CSSASCISEN LASTSKEVPQ  240
IASGNIASVE IPGNCDIPDD VFTLEEFFPE NGNLNFGVAD GFQFPFLVVL PAYYCSYTLH  300
HQGQELATLA ASKYKDETDT IFNDLEDLGG WSPLNGDGNA CVTGHGVIYS SEPTYPSNNE  360
TMFSSDQRLY LELNDLETPL SSTYQDMQMS NAAYNGPSVT EQPCIPYSSF RVANQNVPPC  420
QYPSLHHSND RIRHPTDLGY PAVDMSASIQ SAWVQENFHP NSNVGCSGNK AYWDHDTNLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-44515614168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-118LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-118LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441051.10.0PREDICTED: NAC domain-containing protein 82
SwissprotQ9FY824e-84NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A1S3B3A90.0A0A1S3B3A9_CUCME; NAC domain-containing protein 82
STRINGXP_008441051.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-81NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]